FMO2 Antibody

Images

 
Western Blot: FMO2 Antibody [NBP1-85952] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human lung shows moderate cytoplasmic positivity in alveolar macrophages.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FMO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLFGESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FMO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FMO2 Protein (NBP1-85952PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FMO2 Antibody

  • dimethylaniline monooxygenase [N-oxide-forming] 2
  • Dimethylaniline oxidase 2
  • EC 1.14.13.8
  • flavin containing monooxygenase 2 (non-functional)
  • flavin containing monooxygenase 2
  • FLJ40826
  • FMO 1B1
  • FMO 2
  • FMO, pulmonary
  • FMO1B1
  • Pulmonary flavin-containing monooxygenase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86412
Species: Hu
Applications: IHC, IHC-P
NBP1-33583
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59353
Species: Hu
Applications: WB
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF5924
Species: Hu
Applications: WB, Simple Western

Publications for FMO2 Antibody (NBP1-85952) (0)

There are no publications for FMO2 Antibody (NBP1-85952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMO2 Antibody (NBP1-85952) (0)

There are no reviews for FMO2 Antibody (NBP1-85952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FMO2 Antibody (NBP1-85952) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FMO2 Products

Bioinformatics Tool for FMO2 Antibody (NBP1-85952)

Discover related pathways, diseases and genes to FMO2 Antibody (NBP1-85952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMO2 Antibody (NBP1-85952)

Discover more about diseases related to FMO2 Antibody (NBP1-85952).
 

Pathways for FMO2 Antibody (NBP1-85952)

View related products by pathway.

PTMs for FMO2 Antibody (NBP1-85952)

Learn more about PTMs related to FMO2 Antibody (NBP1-85952).

Blogs on FMO2

There are no specific blogs for FMO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO2