Flt-3 Ligand/FLT3L Antibody - BSA Free

Western Blot: Flt3 ligand Antibody [NBP1-62304] - Human Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Flt-3 Ligand/FLT3L Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FLT3LG(fms-related tyrosine kinase 3 ligand) The peptide sequence was selected form the N terminal of FLT3LG. Peptide sequence TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FLT3LG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Flt-3 Ligand/FLT3L Antibody - BSA Free

• FL
• FLG3L
• Flt3 ligand
• Flt-3 Ligand
• Flt3L
• FLT3LG
• fms-related tyrosine kinase 3 ligand
• SL cytokine

Background

FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FLT3LG
• OMIM:
  • NP_001450(Human)
• Uniprot:
  • P49771(Human)