FLJ10808 Antibody


Western Blot: FLJ10808 Antibody [NBP2-87449] - Host: Rabbit. Target Name: UBA6. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity Hu, Mu, Rt, Po, Ca, EqSpecies Glossary
Applications WB

Order Details

FLJ10808 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human FLJ10808. Peptide sequence: KIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Porcine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for FLJ10808 Antibody

  • E1-L2
  • FLJ10808
  • FLJ23367
  • Monocyte protein 4
  • MOP4
  • MOP-4
  • UBA6, ubiquitin-activating enzyme E1
  • UBE1L2
  • Ubiquitin-activating enzyme 6
  • ubiquitin-activating enzyme E1-like 2
  • Ubiquitin-activating enzyme E1-like protein 2
  • ubiquitin-like modifier activating enzyme 6
  • ubiquitin-like modifier-activating enzyme 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IP, PEP-ELISA, ChIP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Ca, Eq
Applications: WB

Publications for FLJ10808 Antibody (NBP2-87449) (0)

There are no publications for FLJ10808 Antibody (NBP2-87449).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ10808 Antibody (NBP2-87449) (0)

There are no reviews for FLJ10808 Antibody (NBP2-87449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLJ10808 Antibody (NBP2-87449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FLJ10808 Products

Bioinformatics Tool for FLJ10808 Antibody (NBP2-87449)

Discover related pathways, diseases and genes to FLJ10808 Antibody (NBP2-87449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ10808 Antibody (NBP2-87449)

Discover more about diseases related to FLJ10808 Antibody (NBP2-87449).

Pathways for FLJ10808 Antibody (NBP2-87449)

View related products by pathway.

PTMs for FLJ10808 Antibody (NBP2-87449)

Learn more about PTMs related to FLJ10808 Antibody (NBP2-87449).

Blogs on FLJ10808

There are no specific blogs for FLJ10808, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FLJ10808 Antibody and receive a gift card or discount.


Gene Symbol UBA6