FKBPL Antibody

Images

 
Immunohistochemistry-Paraffin: FKBPL Antibody [NBP2-14018] - Staining of human thyroid gland shows high expression.
Immunohistochemistry: FKBPL Antibody [NBP2-14018] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FKBPL Antibody [NBP2-14018] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: FKBPL Antibody [NBP2-14018] - Staining in human thyroid gland and pancreas tissues using anti-FKBPL antibody. Corresponding FKBPL RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBPL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGN LEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQ
Specificity
Specificity of human FKBPL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBPL Protein (NBP2-14018PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBPL Antibody

  • DIR1WISP39
  • FK506 binding protein like
  • FK506-binding protein like
  • NG7FK506-binding protein-like
  • WAF-1/CIP1 stabilizing protein 39
  • WISp39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-66154
Species: Hu
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NBL1-12547
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-07010
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50323
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
MAB1936
Species: Hu
Applications: WB, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA, KO
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14018
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FKBPL Antibody (NBP2-14018) (0)

There are no publications for FKBPL Antibody (NBP2-14018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBPL Antibody (NBP2-14018) (0)

There are no reviews for FKBPL Antibody (NBP2-14018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FKBPL Antibody (NBP2-14018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBPL Products

Bioinformatics Tool for FKBPL Antibody (NBP2-14018)

Discover related pathways, diseases and genes to FKBPL Antibody (NBP2-14018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBPL Antibody (NBP2-14018)

Discover more about diseases related to FKBPL Antibody (NBP2-14018).
 

Pathways for FKBPL Antibody (NBP2-14018)

View related products by pathway.

PTMs for FKBPL Antibody (NBP2-14018)

Learn more about PTMs related to FKBPL Antibody (NBP2-14018).

Blogs on FKBPL

There are no specific blogs for FKBPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBPL