Recombinant Human Ficolin-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Ficolin-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00002219-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Ficolin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FCN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY

Protein/Peptide Type
Partial Recombinant Protein
Gene
FCN1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ficolin-1 Protein

  • Collagen/fibrinogen domain-containing protein 1
  • FCN1
  • Fcna
  • FCNM
  • FCNMficolin-A
  • ficolin (collagen/fibrinogen domain containing) 1
  • ficolin (collagen/fibrinogen domain-containing) 1
  • Ficolin1
  • Ficolin-1
  • Ficolin-A
  • ficolin-alpha
  • M-ficolin

Background

FCN1 - ficolin (collagen/fibrinogen domain containing) 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2428
Species: Hu
Applications: WB
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1724
Species: Hu
Applications: WB, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00000712-P01
Species: Hu
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for Ficolin-1 Partial Recombinant Protein (H00002219-Q01) (0)

There are no publications for Ficolin-1 Partial Recombinant Protein (H00002219-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ficolin-1 Partial Recombinant Protein (H00002219-Q01) (0)

There are no reviews for Ficolin-1 Partial Recombinant Protein (H00002219-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ficolin-1 Partial Recombinant Protein (H00002219-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ficolin-1 Products

Bioinformatics Tool for Ficolin-1 Partial Recombinant Protein (H00002219-Q01)

Discover related pathways, diseases and genes to Ficolin-1 Partial Recombinant Protein (H00002219-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ficolin-1 Partial Recombinant Protein (H00002219-Q01)

Discover more about diseases related to Ficolin-1 Partial Recombinant Protein (H00002219-Q01).
 

Pathways for Ficolin-1 Partial Recombinant Protein (H00002219-Q01)

View related products by pathway.

PTMs for Ficolin-1 Partial Recombinant Protein (H00002219-Q01)

Learn more about PTMs related to Ficolin-1 Partial Recombinant Protein (H00002219-Q01).

Blogs on Ficolin-1

There are no specific blogs for Ficolin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ficolin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FCN1
Entrez