Fibulin 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Fibulin 2 Antibody [NBP1-88115] - Immunofluorescent staining of human cell line BJ shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human skin shows distinct positivity in connective tissue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fibulin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBLN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Fibulin 2 Protein (NBP1-88115PEP)
Publications
Read Publication using NBP1-88115.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fibulin 2 Antibody

  • FBLN2
  • FIBL-2
  • Fibulin 2
  • Fibulin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
MAB3095
Species: Hu
Applications: WB, IHC
AF3385
Species: Hu
Applications: WB, IHC
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2570
Species: Hu
Applications: WB, IHC
AF6235
Species: Hu
Applications: WB
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
H00114757-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF5800
Species: Mu, Rt
Applications: WB, IHC
NBP1-88115
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Fibulin 2 Antibody (NBP1-88115)(1)

Reviews for Fibulin 2 Antibody (NBP1-88115) (0)

There are no reviews for Fibulin 2 Antibody (NBP1-88115). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Fibulin 2 Antibody (NBP1-88115) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibulin 2 Products

Bioinformatics Tool for Fibulin 2 Antibody (NBP1-88115)

Discover related pathways, diseases and genes to Fibulin 2 Antibody (NBP1-88115). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibulin 2 Antibody (NBP1-88115)

Discover more about diseases related to Fibulin 2 Antibody (NBP1-88115).
 

Pathways for Fibulin 2 Antibody (NBP1-88115)

View related products by pathway.

PTMs for Fibulin 2 Antibody (NBP1-88115)

Learn more about PTMs related to Fibulin 2 Antibody (NBP1-88115).

Blogs on Fibulin 2

There are no specific blogs for Fibulin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibulin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLN2
Entrez