Fibulin 1 Antibody (4C9)

Images

 
Western Blot: Fibulin 1 Antibody (4C9) [H00002192-M01] - FBLN1 monoclonal antibody (M01), clone 4C9 Analysis of FBLN1 expression in A-431.
Western Blot: Fibulin 1 Antibody (4C9) [H00002192-M01] - Analysis of FBLN1 expression in transfected 293T cell line by FBLN1 monoclonal antibody (M01), clone 4C9.Lane 1: FBLN1 transfected lysate(74.4 KDa).Lane 2: ...read more
Immunoprecipitation: Fibulin 1 Antibody (4C9) [H00002192-M01] - Analysis of FBLN1 transfected lysate using anti-FBLN1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FBLN1 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
4C9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fibulin 1 Antibody (4C9) Summary

Immunogen
FBLN1 (AAH22497, 151 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT
Specificity
FBLN1 - fibulin 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBLN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fibulin 1 Antibody (4C9)

  • FBLN
  • FBLN1
  • FIBL1
  • FIBL-1
  • Fibulin 1
  • fibulin-1

Background

Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6235
Species: Hu
Applications: WB
AF143
Species: Hu
Applications: WB, Simple Western, IHC
MAB3095
Species: Hu
Applications: WB, IHC
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
AF3385
Species: Hu
Applications: WB, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2327
Species: Hu
Applications: WB, IP
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF5800
Species: Mu, Rt
Applications: WB, IHC

Publications for Fibulin 1 Antibody (H00002192-M01) (0)

There are no publications for Fibulin 1 Antibody (H00002192-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibulin 1 Antibody (H00002192-M01) (0)

There are no reviews for Fibulin 1 Antibody (H00002192-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibulin 1 Antibody (H00002192-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibulin 1 Products

Bioinformatics Tool for Fibulin 1 Antibody (H00002192-M01)

Discover related pathways, diseases and genes to Fibulin 1 Antibody (H00002192-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibulin 1 Antibody (H00002192-M01)

Discover more about diseases related to Fibulin 1 Antibody (H00002192-M01).
 

Pathways for Fibulin 1 Antibody (H00002192-M01)

View related products by pathway.

PTMs for Fibulin 1 Antibody (H00002192-M01)

Learn more about PTMs related to Fibulin 1 Antibody (H00002192-M01).
 

Research Areas for Fibulin 1 Antibody (H00002192-M01)

Find related products by research area.

Blogs on Fibulin 1

There are no specific blogs for Fibulin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibulin 1 Antibody (4C9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLN1
Entrez
OMIM
Uniprot