Fibrinogen gamma chain Antibody (1F2) - Azide and BSA Free

Western Blot: Fibrinogen gamma chain Antibody (1F2) [H00002266-M01] - FGG monoclonal antibody (M01), clone 1F2 Analysis of FGG expression in Hela S3 NE.

Immunohistochemistry-Paraffin: Fibrinogen gamma chain Antibody (1F2) [H00002266-M01] - Analysis of monoclonal antibody to FGG on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue. Antibody concentration 1 ug/ml.

Proximity Ligation Assay: Fibrinogen gamma chain Antibody (1F2) [H00002266-M01] - Analysis of protein-protein interactions between ICAM1 and FGG. HeLa cells were stained with anti-ICAM1 rabbit purified polyclonal 1:1200 and anti-FGG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Sandwich ELISA: Fibrinogen gamma chain Antibody (1F2) [H00002266-M01] - Detection limit for recombinant GST tagged FGG is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Func, IHC
• Clone: 1F2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Fibrinogen gamma chain Antibody (1F2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FGG (AAH07044, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD
• Specificity: FGG - fibrinogen gamma chain
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FGG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fibrinogen gamma chain Antibody (1F2) - Azide and BSA Free

• fibrinogen gamma chain
• fibrinogen, gamma polypeptide

Background

The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Fibrinogen gamma chain Antibody (H00002266-M01)(6)

Publications using H00002266-M01

• Onouchi T, Shiogama K, Matsui T et al. Visualization of Neutrophil Extracellular Traps and Fibrin Meshwork in Human Fibrinopurulent Inflammatory Lesions: II. Ultrastructural Study. Acta Histochem Cytochem 2016-07-30 [PMID: 27917008]
• Shiogama K, Onouchi T, Mizutani Y et al. Visualization of Neutrophil Extracellular Traps and Fibrin Meshwork in Human Fibrinopurulent Inflammatory Lesions: I. Light Microscopic Study. Acta Histochem Cytochem 2016-07-30 [PMID: 27682014]
• Verrills NM, Irwin JA, He XY et al. Identification of Novel Diagnostic Biomarkers for Asthma and Chronic Obstructive Pulmonary Disease. Am J Respir Crit Care Med. 2011-03-18 [PMID: 21471098]
• Shiogama K,Onouchi T, Mizutani Y et al. Visualization of Neutrophil Extracellular Traps and Fibrin Meshwork in Human Fibrinopurulent Inflammatory Lesions: I. Light Microscopic Study. Acta Histochem Cytochem Jul 30 2016
• Visualization of Neutrophil Extracellular Traps and Fibrin Meshwork in Human Fibrinopurulent Inflammatory Lesions: II. Ultrastructural Study Onouchi T, Shiogama K, Matsui T et al. Acta Histochem Cytochem [PMID: 27682015] (IHC-P, Human)
• Horlock C, Shakib F, Mahdavi J et al. Analysis of proteomic profiles and functional properties of human peripheral blood myeloid dendritic cells, monocyte-derived dendritic cells and the dendritic cell-like KG-1 cells reveals distinct characteristics. Genome Biol 2007-03-01 [PMID: 17331236]

Bioinformatics

• Gene Symbol: FGG
• Entrez:
  • 2266(Human)
• OMIM:
  • 134850(Human)
• Uniprot:
  • AAH07044(Human)