Fibrinogen gamma chain Antibody (1E2.)

Images

 
Sandwich ELISA: Fibrinogen gamma chain Antibody (1E2) [H00002266-M02] - Detection limit for recombinant GST tagged FGG is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fibrinogen gamma chain Antibody (1E2.) Summary

Immunogen
FGG (AAH07044, 31 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fibrinogen gamma chain Antibody (1E2.)

  • fibrinogen gamma chain
  • fibrinogen, gamma polypeptide

Background

The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33582
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Fibrinogen gamma chain Antibody (H00002266-M02) (0)

There are no publications for Fibrinogen gamma chain Antibody (H00002266-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibrinogen gamma chain Antibody (H00002266-M02) (0)

There are no reviews for Fibrinogen gamma chain Antibody (H00002266-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibrinogen gamma chain Antibody (H00002266-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibrinogen gamma chain Products

Bioinformatics Tool for Fibrinogen gamma chain Antibody (H00002266-M02)

Discover related pathways, diseases and genes to Fibrinogen gamma chain Antibody (H00002266-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibrinogen gamma chain Antibody (H00002266-M02)

Discover more about diseases related to Fibrinogen gamma chain Antibody (H00002266-M02).
 

Pathways for Fibrinogen gamma chain Antibody (H00002266-M02)

View related products by pathway.

PTMs for Fibrinogen gamma chain Antibody (H00002266-M02)

Learn more about PTMs related to Fibrinogen gamma chain Antibody (H00002266-M02).
 

Research Areas for Fibrinogen gamma chain Antibody (H00002266-M02)

Find related products by research area.

Blogs on Fibrinogen gamma chain.

CD11b Expression, Leukocyte Adhesion and the Innate Immune System
CD11b is an integrin family member which pairs with CD18 to form the CR3 heterodimer. CD11b is expressed on the surface of many leukocytes including monocytes, neutrophils, natural killer cells, granulocytes and macrophages, as well as on 8% of spleen...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibrinogen gamma chain Antibody (1E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGG
Uniprot