Recombinant Human FAM180A GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FAM180A Protein [H00389558-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FAM180A GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 173 of Human UNQ1940 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHWKMLLLLLLYYNAEASMCHRWSRAVLFPAAHRPKRSSSLPLNPVLQTSLEEVELLYEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNNVIPKSIPDIRRLSASLSSHPGILKKEDFERTVLTLAYTAYRTALSHGHQKDIWAQSLVSLFQALRHDLMRSSQPGVPP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FAM180A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
46.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAM180A GST (N-Term) Protein

  • family with sequence similarity 180, member A
  • HWKM1940
  • hypothetical protein LOC389558
  • UNQ1940

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-252-PB
Species: Hu
Applications: WB, IHC
NBP1-97766
Species: Hu
Applications: WB, PEP-ELISA
AF482
Species: Mu
Applications: WB, IHC
NBP1-31365
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81154
Species: Hu
Applications: WB, IHC, IHC-P
AF1568
Species: Mu
Applications: WB
AF4817
Species: Mu
Applications: WB
NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
H00057509-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF3646
Species: Hu
Applications: WB, ICC
NBP2-45628
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PEP-ELISA

Publications for FAM180A Recombinant Protein (H00389558-P01) (0)

There are no publications for FAM180A Recombinant Protein (H00389558-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM180A Recombinant Protein (H00389558-P01) (0)

There are no reviews for FAM180A Recombinant Protein (H00389558-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM180A Recombinant Protein (H00389558-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional FAM180A Products

Bioinformatics Tool for FAM180A Recombinant Protein (H00389558-P01)

Discover related pathways, diseases and genes to FAM180A Recombinant Protein (H00389558-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM180A Recombinant Protein (H00389558-P01)

Discover more about diseases related to FAM180A Recombinant Protein (H00389558-P01).
 

Pathways for FAM180A Recombinant Protein (H00389558-P01)

View related products by pathway.

Blogs on FAM180A

There are no specific blogs for FAM180A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAM180A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM180A