FHL3 Antibody (2C10)

Images

 
Sandwich ELISA: FHL3 Antibody (2C10) [H00002275-M01] - Detection limit for recombinant GST tagged FHL3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FHL3 Antibody (2C10) Summary

Immunogen
FHL3 (NP_004459.2 3 a.a. - 102 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCS
Specificity
FHL3 - four and a half LIM domains 3 (2C10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FHL3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FHL3 Antibody (2C10)

  • FHL-3
  • four and a half LIM domains 3
  • four and a half LIM domains protein 3
  • LIM-only protein FHL3
  • MGC19547
  • MGC8696
  • Skeletal muscle LIM-protein 2
  • SLIM-2
  • SLIM2MGC23614

Background

LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84978
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86122
Species: Hu
Applications: WB, IHC, IHC-P
AF5900
Species: Hu
Applications: WB
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP

Publications for FHL3 Antibody (H00002275-M01) (0)

There are no publications for FHL3 Antibody (H00002275-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHL3 Antibody (H00002275-M01) (0)

There are no reviews for FHL3 Antibody (H00002275-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHL3 Antibody (H00002275-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHL3 Products

Bioinformatics Tool for FHL3 Antibody (H00002275-M01)

Discover related pathways, diseases and genes to FHL3 Antibody (H00002275-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHL3 Antibody (H00002275-M01)

Discover more about diseases related to FHL3 Antibody (H00002275-M01).
 

Pathways for FHL3 Antibody (H00002275-M01)

View related products by pathway.

PTMs for FHL3 Antibody (H00002275-M01)

Learn more about PTMs related to FHL3 Antibody (H00002275-M01).

Blogs on FHL3

There are no specific blogs for FHL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHL3 Antibody (2C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol FHL3
Entrez
Uniprot