FGL2/Fibroleukin Antibody

Images

 
Western Blot: FGL2/Fibroleukin Antibody [NBP1-87198] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-218
Immunohistochemistry-Paraffin: FGL2/Fibroleukin Antibody [NBP1-87198] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGL2/Fibroleukin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGL2/Fibroleukin Protein (NBP1-87198PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGL2/Fibroleukin Antibody

  • FGL2
  • fibrinogen-like 2
  • Fibrinogen-like protein 2
  • Fibroleukin
  • pT49T49
  • T49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-87198
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FGL2/Fibroleukin Antibody (NBP1-87198) (0)

There are no publications for FGL2/Fibroleukin Antibody (NBP1-87198).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGL2/Fibroleukin Antibody (NBP1-87198) (0)

There are no reviews for FGL2/Fibroleukin Antibody (NBP1-87198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGL2/Fibroleukin Antibody (NBP1-87198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGL2/Fibroleukin Products

Bioinformatics Tool for FGL2/Fibroleukin Antibody (NBP1-87198)

Discover related pathways, diseases and genes to FGL2/Fibroleukin Antibody (NBP1-87198). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGL2/Fibroleukin Antibody (NBP1-87198)

Discover more about diseases related to FGL2/Fibroleukin Antibody (NBP1-87198).
 

Pathways for FGL2/Fibroleukin Antibody (NBP1-87198)

View related products by pathway.

PTMs for FGL2/Fibroleukin Antibody (NBP1-87198)

Learn more about PTMs related to FGL2/Fibroleukin Antibody (NBP1-87198).
 

Research Areas for FGL2/Fibroleukin Antibody (NBP1-87198)

Find related products by research area.

Blogs on FGL2/Fibroleukin

There are no specific blogs for FGL2/Fibroleukin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGL2/Fibroleukin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGL2
Entrez