FGF18 Antibody - Azide and BSA Free

Western Blot: FGF18 Antibody [H00008817-B01P] - Analysis of FGF18 expression in transfected 293T cell line by FGF18 polyclonal antibody. Lane 1: FGF18 transfected lysate(22.77 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Bv
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FGF18 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: FGF18 (NP_003853.1, 1 a.a. - 207 a.a.) full-length human protein. MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
• Specificity: FGF18 - fibroblast growth factor 18,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FGF18
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 20484739).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF18 Antibody - Azide and BSA Free

• FGF18
• FGF-18
• FGF-18ZFGF5
• fibroblast growth factor 18
• zFGF5

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FGF18 Antibody (H00008817-B01P)(1)

Publication using H00008817-B01P

• Portela VM, Machado M, Buratini J Jr et al. Expression and function of fibroblast growth factor 18 in the ovarian follicle in cattle. Biol Reprod 2010-09-01 [PMID: 20484739] (WB, Bovine)

Bioinformatics

• Gene Symbol: FGF18
• Entrez:
  • 8817(Human)
• Uniprot:
  • NP_003853.1(Human)