FGF18 Antibody

Images

 
Western Blot: FGF18 Antibody [H00008817-B01P] - Analysis of FGF18 expression in transfected 293T cell line by FGF18 polyclonal antibody. Lane 1: FGF18 transfected lysate(22.77 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGF18 Antibody Summary

Immunogen
FGF18 (NP_003853.1, 1 a.a. - 207 a.a.) full-length human protein. MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
Specificity
FGF18 - fibroblast growth factor 18,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FGF18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.
Publications
Read Publication using
H00008817-B01P in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF18 Antibody

  • FGF18
  • FGF-18
  • FGF-18ZFGF5
  • fibroblast growth factor 18
  • zFGF5

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB319
Species: Hu
Applications: WB, IHC
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
AF1212
Species: Hu, Mu
Applications: WB, IHC, ICC, Neut
AF2265
Species: Mu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for FGF18 Antibody (H00008817-B01P)(1)

We have publications tested in 1 confirmed species: Bovine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Bovine
(1)
All Species

Reviews for FGF18 Antibody (H00008817-B01P) (0)

There are no reviews for FGF18 Antibody (H00008817-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF18 Antibody (H00008817-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF18 Products

Bioinformatics Tool for FGF18 Antibody (H00008817-B01P)

Discover related pathways, diseases and genes to FGF18 Antibody (H00008817-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF18 Antibody (H00008817-B01P)

Discover more about diseases related to FGF18 Antibody (H00008817-B01P).
 

Pathways for FGF18 Antibody (H00008817-B01P)

View related products by pathway.

PTMs for FGF18 Antibody (H00008817-B01P)

Learn more about PTMs related to FGF18 Antibody (H00008817-B01P).
 

Research Areas for FGF18 Antibody (H00008817-B01P)

Find related products by research area.

Blogs on FGF18

There are no specific blogs for FGF18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF18
Entrez
Uniprot