Fetuin Recombinant Protein Antigen (NBP1-91192PEP)

Images

 
There are currently no images for Fetuin Protein (NBP1-91192PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fetuin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FETUB.

Source: E.coli

Amino Acid Sequence: FYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWV

Protein/Peptide Type
Recombinant Protein Antigen
Gene
FETUB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-91192.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fetuin Recombinant Protein Antigen

  • fetuin B
  • fetuin-B
  • Fetuin-like protein IRL685,16G2
  • Gugu
  • IRL685

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1905
Species: Mu
Applications: WB
AF1396
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4764
Species: Hu
Applications: WB, IHC, ICC
MAB1569
Species: Hu
Applications: WB, IHC, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
MAB1268
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-84570
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85404
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-91870
Species: Hu
Applications: IHC, IHC-P

Publications for Fetuin Protein (NBP1-91192PEP) (0)

There are no publications for Fetuin Protein (NBP1-91192PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fetuin Protein (NBP1-91192PEP) (0)

There are no reviews for Fetuin Protein (NBP1-91192PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Fetuin Protein (NBP1-91192PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fetuin Products

Related Products by Gene

Bioinformatics Tool for Fetuin Protein (NBP1-91192PEP)

Discover related pathways, diseases and genes to Fetuin Protein (NBP1-91192PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fetuin Protein (NBP1-91192PEP)

Discover more about diseases related to Fetuin Protein (NBP1-91192PEP).
 

Pathways for Fetuin Protein (NBP1-91192PEP)

View related products by pathway.

PTMs for Fetuin Protein (NBP1-91192PEP)

Learn more about PTMs related to Fetuin Protein (NBP1-91192PEP).

Blogs on Fetuin

There are no specific blogs for Fetuin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
Fetuin Antibody
NBP2-16470
Fetuin Antibody
NBP2-16470
Fetuin Antibody
NBP2-16470

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fetuin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FETUB