Recombinant Human Fetuin A/AHSG Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Fetuin A/AHSG Peptides and Proteins

Order Details


    • Catalog Number
      H00000197-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Fetuin A/AHSG Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-349 of Human AHSG full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Protein/Peptide Type
Recombinant Protein
Gene
AHSG

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fetuin A/AHSG Protein

  • A2HS
  • AHS
  • AHSG
  • alpha-2-HS-glycoprotein
  • alpha-2-Z-globulin
  • Ba-alpha-2-glycoprotein
  • FETUAba-alpha-2-glycoprotein
  • Fetuin A
  • fetuin-A
  • HSGA

Background

AHSG( AAH48198, 19 a.a. - 368 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-35213
Species: Hu
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF4409
Species: Mu
Applications: WB
NBP2-45844
Species: Hu
Applications: WB, IHC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
2629-FG/CF
Species: Mu
MAB3694
Species: Hu
Applications: WB, IHC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr

Publications for Fetuin A/AHSG Recombinant Protein (H00000197-P01) (0)

There are no publications for Fetuin A/AHSG Recombinant Protein (H00000197-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fetuin A/AHSG Recombinant Protein (H00000197-P01) (0)

There are no reviews for Fetuin A/AHSG Recombinant Protein (H00000197-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fetuin A/AHSG Recombinant Protein (H00000197-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fetuin A/AHSG Products

Bioinformatics Tool for Fetuin A/AHSG Recombinant Protein (H00000197-P01)

Discover related pathways, diseases and genes to Fetuin A/AHSG Recombinant Protein (H00000197-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fetuin A/AHSG Recombinant Protein (H00000197-P01)

Discover more about diseases related to Fetuin A/AHSG Recombinant Protein (H00000197-P01).
 

Pathways for Fetuin A/AHSG Recombinant Protein (H00000197-P01)

View related products by pathway.

PTMs for Fetuin A/AHSG Recombinant Protein (H00000197-P01)

Learn more about PTMs related to Fetuin A/AHSG Recombinant Protein (H00000197-P01).
 

Research Areas for Fetuin A/AHSG Recombinant Protein (H00000197-P01)

Find related products by research area.

Blogs on Fetuin A/AHSG

There are no specific blogs for Fetuin A/AHSG, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fetuin A/AHSG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AHSG
Entrez