Fetuin A/AHSG Recombinant Protein Antigen

Images

 
There are currently no images for Fetuin A/AHSG Protein (NBP1-90303PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fetuin A/AHSG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AHSG.

Source: E. coli

Amino Acid Sequence: LPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AHSG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90303. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fetuin A/AHSG Recombinant Protein Antigen

  • A2HS
  • AHS
  • AHSG
  • alpha-2-HS-glycoprotein
  • alpha-2-Z-globulin
  • Ba-alpha-2-glycoprotein
  • FETUAba-alpha-2-glycoprotein
  • Fetuin A
  • fetuin-A
  • HSGA

Background

Human fetuin (2-Heremans-Schmid-glycoprotein or a2-HS glycoprotein) is a major plasma glycoprotein predominantly synthesized in the liver. Human fetuin is named after its bovine homolog. Fetuins are found in most mammals. Human fetuin is a negative acute-phase protein; normal circulating levels in adults (300600 g/ml) fall significantly (3050%) during injury and infection. The biological role of fetuin is unknown, although it has been implicated as an immunomodulator that can participate in stimulation of bacterial phagocytosis by neutrophils and promotion of endocytosis by mouse macrophages. Hepatocytes are the principal cell source of circulating fetuin, but it also is expressed by monocyte/macrophages. Fetuins occur in large amounts in blood and cerebrospinal fluid and accumulate to high concentrations in calcified bone. The fetuin promoter region has several potential interleukin 6-responsive elements, and its synthesis is down-regulated during injury and inflammation. Fetuin is an acidic glycoprotein with three N-linked and three O-linked oligosaccharide chains, whose terminal sugar residues are rich in sialic acid (N-acetylneuraminic acid), contributing to its net negative charge. A role for fetuin as a carrier of bioactive molecules has been proposed based on observations that it binds and carries Ca2+ ion. Fetuin is implicated in bone remodeling, immune function and may play a role in tumor progression of certain cell types. Fetuin plays a role as an anti-inflammatory agent by suppressing the release of TNF from stimulated macrophages. Fetuin also interacts with members of the matrix metalloprotease family of zinc dependent secreted transmembrane proteins that degrade basement membranes and extracellular matrix components. The biological activity of fetuin is mediated through its direct interaction with other proteins. Fetuin down-regulates a number of receptor tyrosine kinase family members. A motif within fetuin has homology to the TGF-b receptor type II. Circulating human plasma fetuin is partly phosphorylated which implies that phosphorylated fetuin may have a physiological function in vivo. Human fetuin isolated from plasma is a two-chain molecule consisting of a A-chain of 322 amino acid residues (53 kDa) and a B-chain of 27 residues (5 kDa). The carboxy terminal 40 amino acids of the A chain constitute a bridging peptide that may be removed proteolytically in vivo. A single mRNA encodes both the A and B chains. The apparent molecular weight of intact human fetuin is 58 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY1707
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
DY805
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
MAB7665
Species: Hu
Applications: IHC, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89796
Species: Hu, Mu
Applications: IHC,  IHC-P
2914-HT
Species: Hu
Applications: BA
DHAPG0
Species: Hu
Applications: ELISA
NBP2-45844
Species: Hu
Applications: IHC,  IHC-P, WB
1544-IR
Species: Hu
Applications: Bind
DRP300
Species: Hu
Applications: ELISA
MAB26291
Species: Mu
Applications: IHC
MAB3694
Species: Hu
Applications: IHC, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90303PEP
Species: Hu
Applications: AC

Publications for Fetuin A/AHSG Protein (NBP1-90303PEP) (0)

There are no publications for Fetuin A/AHSG Protein (NBP1-90303PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fetuin A/AHSG Protein (NBP1-90303PEP) (0)

There are no reviews for Fetuin A/AHSG Protein (NBP1-90303PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fetuin A/AHSG Protein (NBP1-90303PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fetuin A/AHSG Products

Research Areas for Fetuin A/AHSG Protein (NBP1-90303PEP)

Find related products by research area.

Blogs on Fetuin A/AHSG

There are no specific blogs for Fetuin A/AHSG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fetuin A/AHSG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AHSG