Home » Fes » Fes Peptides and Proteins » Fes Recombinant Protein Antigen

Fes Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Fes Protein (NBP1-83429PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Fes Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FES.

Source: E.coli

Amino Acid Sequence: DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FES
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83429.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Fes Recombinant Protein Antigen

  • EC 2.7.10
  • EC 2.7.10.2
  • feline sarcoma oncogene
  • feline sarcoma virus
  • Fes
  • FPS
  • Proto-oncogene c-Fes
  • Proto-oncogene c-Fps
  • proto-oncogene tyrosine-protein kinase Fes/Fps
  • tyrosine-protein kinase Fes/Fps

Background

FES (FES feline sarcoma oncogene) has tyrosine-specific protein kinase activity which is required for cellular transformation maintenance. FES plays a role in regulation of cell attachment, cell spreading, cell differentiation and microtubule assembly as well as being involved in cell scattering. FES is known to have interactions with ERZ, NSF, EGFR, CSF2RB and RASA1. This protein is currently being studied for research on the following diseases and disorders: sarcoma, leukemia, colon cancer, neuronitis, hemangioma and hematopoiesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Fer Antibody - BSA
Free
NBP1-20089
Knockdown Validated: Fer Antibody [NBP1-20089] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Fer knockout (KO) HeLa cell line. PVDF membrane was probed with 0.5 ug/ml of Rabbit Anti-Human Fer Polyclonal Antibody (Catalog # NBP1-20089) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Fer at approximately 90 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: FER Antibody [NBP1-20089] - Jurkat cell lysates.
Immunocytochemistry/Immunofluorescence: FER Antibody [NBP1-20089] - FER antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Species: Hu
Applications: ICC/IF, KD, WB
FDPS Antibody
NBP2-16463
Western Blot: FDPS Antibody [NBP2-16463] - A. 50 ug rat liver lysate/extract 10% SDS-PAGE FDPS antibody dilution: 1:5000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: FDPS Antibody [NBP2-16463] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FDPS antibody [N1C3] diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: FDPS Antibody [NBP2-16463] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: FDPS protein stained by FDPS antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: Simple Western, WB
GGPS1 Antibody
NBP1-83368
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining in human testis and pancreas tissues using anti-GGPS1 antibody. Corresponding GGPS1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
MTTP Antibody
NBP1-62489
Western Blot: MTTP Antibody [NBP1-62489] - Adult mouse small intestine homogenate, 20 ug total protein per lane. Antibody at 1:1000. Secondary HRP conjugated antibody at 1:5000. Bands visualized with Western Chemiluminescence HRP substrate, imaged with Syngene imaging system. WB image submitted by a verified customer review.
Western Blot: MTTP Antibody [NBP1-62489] - HepG2 cell lysate.
(1 Review)
(1 Publication)
Species: Dr, Hu, Mu
Applications: WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(41 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(185 Publications)
Species: Hu
Applications: BA
Factor XIIIa
Antibody (OTI6F5) - A ...
NBP2-70696
Western Blot: Factor XIIIa Antibody (OTI6F5) - Azide and BSA Free [NBP2-70696] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Factor XIIa.
Flow Cytometry: Factor XIIIa Antibody (OTI6F5) - Azide and BSA Free [NBP2-70696] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by F13A1 antibody.
Immunohistochemistry: Factor XIIIa Antibody (OTI6F5) - Azide and BSA Free [NBP2-70696] - Analysis of Adenocarcinoma of Human breast tissue.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Complement
Component C5a [Biotin
DY2037
(22 Publications)
Species: Hu
Applications: ELISA
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(2 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
CRAT Antibody
NBP1-86616
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Cip4 Antibody (1A9)
H00009322-M01
Immunoprecipitation: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of TRIP10 transfected lysate using anti-TRIP10 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIP10 MaxPab rabbit polyclonal antibody.
Immunocytochemistry/Immunofluorescence: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of monoclonal antibody to TRIP10 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Fes Recombinant
Protein Antigen
NBP1-83429PEP
Fes Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Fes Protein (NBP1-83429PEP) (0)

There are no publications for Fes Protein (NBP1-83429PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fes Protein (NBP1-83429PEP) (0)

There are no reviews for Fes Protein (NBP1-83429PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fes Protein (NBP1-83429PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fes Products

Array NBP1-83429PEP

Bioinformatics Tool for Fes Protein (NBP1-83429PEP)

Discover related pathways, diseases and genes to Fes Protein (NBP1-83429PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fes Protein (NBP1-83429PEP)

Discover more about diseases related to Fes Protein (NBP1-83429PEP).
 

Pathways for Fes Protein (NBP1-83429PEP)

View related products by pathway.

PTMs for Fes Protein (NBP1-83429PEP)

Learn more about PTMs related to Fes Protein (NBP1-83429PEP).
 

Research Areas for Fes Protein (NBP1-83429PEP)

Find related products by research area.

Blogs on Fes

There are no specific blogs for Fes, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fes Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FES