Ferritin Light Chain Antibody - BSA Free

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072] - Analysis in human lung and skeletal muscle tissues using antibody. Corresponding FTL RNA-seq data are presented for the same tissues.

Western Blot: Ferritin Light Chain Antibody [NBP2-34072] - Analysis in human lung tissue.

Immunocytochemistry/Immunofluorescence: Ferritin Light Chain Antibody [NBP2-34072] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: Ferritin Light Chain Antibody [NBP2-34072] - Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ferritin Light Chain Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ferritin Light Chain Antibody - BSA Free (NBP2-34072) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 -1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ferritin Light Chain Recombinant Protein Antigen (NBP2-34072PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ferritin Light Chain Antibody - BSA Free

• Ferritin L subunit
• ferritin L-chain
• ferritin light chain
• ferritin light polypeptide-like 3
• ferritin, light polypeptide
• MGC71996
• NBIA3

Background

This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FTL
• Uniprot:
  • P02792(Human)