FEM1B Antibody (4B12) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: FEM1B Antibody (4B12) [H00010116-M09] - Analysis of monoclonal antibody to FEM1B on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: FEM1B Antibody (4B12) [H00010116-M09] - Detection limit for recombinant GST tagged FEM1B is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 4B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FEM1B Antibody (4B12) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse FEM1B Antibody (4B12) - Azide and BSA Free (H00010116-M09) is a monoclonal antibody validated for use in ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: FEM1B (NP_056137.1, 401 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FEM1B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
• Application Notes: This antibody is useful for ELISA

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FEM1B Antibody (4B12) - Azide and BSA Free

• DKFZp451E0710
• F1AA
• F1A-alpha
• FEM-1 (C.elegans) homolog b
• fem-1 homolog b (C. elegans)
• FEM1b
• FEM1-beta
• FEM-1-like death receptor binding protein
• Fem-1-like death receptor-binding protein alpha
• Fem-1-like in apoptotic pathway protein alpha
• FIAA
• KIAA0396
• protein fem-1 homolog B

Background

Fas and tumor necrosis factor receptor 1 (TNFR1) are two prototype members in the death receptor family. A novel protein that associates with the intracellular domains of Fas and TNFR1 was recently identified and designated F1Aa and FEM1b (1,2). F1Aa/FEM1b is the homologue of C. elegans sex determining protein FEM-1. FEM-1/F1Aa is cleaved by CED-3 and caspase (3). FEM-1/F1Aa associates with CED-4 and its mammalian homologue Apaf-1 (3). Overexpression of F1Aa induces apoptosis. F1Aa is therefore a novel member of the death receptor associated protein that mediates apoptosis. F1Aa is expressed in a variety of human and mouse tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FEM1B
• Uniprot:
  • NP_056137(Human)