ANKRD37 Antibody

Western Blot: ANKRD37 Antibody [NBP1-98583] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ANKRD37 Antibody Summary

• Immunogen: The immunogen for this antibody is Ankrd37 - N-terminal region. Peptide sequence FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNK.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Application Notes: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKRD37 Antibody

• ankyrin repeat domain 37
• ankyrin repeat domain-containing protein 37
• hLrp2bp
• low density lipoprotein receptor-related protein binding protein
• Low-density lipoprotein receptor-related protein 2-binding protein
• LPR2BP
• Lrp2bp
• MGC111507

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD37
• Uniprot:
  • NP_001034651(Mouse)