Home » ANKRD37 » ANKRD37 Research Products » ANKRD37 Antibody

ANKRD37 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ANKRD37 Antibody [NBP1-98583] - Host: Rabbit. Target Name: ANKRD37. Sample Tissue: Mouse Mouse Liver. Antibody Dilution: 1ug/ml
Western Blot: ANKRD37 Antibody [NBP1-98583] - Host: Rabbit. Target Name: ANKRD37. Sample Tissue: Mouse Mouse Liver. Antibody Dilution: 1ug/ml
Western Blot: ANKRD37 Antibody [NBP1-98583] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.

Product Details

Summary
Reactivity Hu, Mu, Hu, Rt, Bv, Gt, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ANKRD37 Antibody Summary

Immunogen
The immunogen for this antibody is Ankrd37 - N-terminal region. Peptide sequence FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNK. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Goat (93%), Bovine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-98583 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Human reported in secitific publication PMID: 32679233

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKRD37 Antibody

  • ankyrin repeat domain 37
  • ankyrin repeat domain-containing protein 37
  • hLrp2bp
  • low density lipoprotein receptor-related protein binding protein
  • Low-density lipoprotein receptor-related protein 2-binding protein
  • LPR2BP
  • Lrp2bp
  • MGC111507

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulysin/IDE
Antibody (JJ0949)
NBP2-66907
Western Blot: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of Insulin degrading enzyme on different lysates using anti-Insulin degrading enzyme antibody at 1/1,000 dilution. Positive control: Lane 1: zebrafish Lane 2: Hela Lane 3: K562
Immunohistochemistry-Paraffin: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of mouse colon tissue using anti-Insulin degrading enzyme antibody. Counter stained with hematoxylin.
Western Blot: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of Insulin degrading enzyme on hybrid fish (crucian-carp) heart tissue lysate using anti-Insulin degrading enzyme antibody at 1/500 dilution.
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, IHC, IHC-P
LRP2 Antibody
(CD7D5)
NB110-96417
Immunohistochemistry: LRP2 Antibody (CD7D5) [NB110-96417] - Representative immunofluorescence stainings of control (Tead4m-z+) and Tead4 maternal/zygotic mutant (Tead4m-z-) embryos for Krt8 and Krt18 (16 cell stage embryos) and Lrp2 and Dab2 (32 to 64 cell stage embryos; Lrp2 and Dab2 were not detected in earlier stage embryos). n indicates total number of embryos analyzed. Scale bar: 25 um. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/22906), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Staining (paraffin-embedded tissue-sections fixed in formalin) of Megalin in the brush border of the proximal tubule.
Immunocytochemistry/Immunofluorescence: LRP2 Antibody (CD7D5) [NB110-96417] - Immunofluorescence staining of Megalin in the brush border of the proximal tubule.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Adenine Nucleotide
Translocase 1 Antibod ...
NBP1-59594
Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - Sample Tissue: Human RPMI-8226 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FRG1 Antibody (4A5)
H00002483-M01
Western Blot: FRG1 Antibody (4A5) [H00002483-M01] - Analysis of FRG1 expression in transfected 293T cell line by FRG1 monoclonal antibody (M01), clone 4A5.Lane 1: FRG1 transfected lysate(29 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: FRG1 Antibody (4A5) [H00002483-M01] - Analysis of monoclonal antibody to FRG1 on HeLa cell. Antibody concentration 35 ug/ml.
Western Blot: FRG1 Antibody (4A5) [H00002483-M01] - FRG1 monoclonal antibody (M01), clone 4A5 Analysis of FRG1 expression in Hela S3 NE.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
PDLIM3 Antibody
NBP1-89134
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining in human skeletal muscle and cerebral cortex tissues using anti-PDLIM3 antibody. Corresponding PDLIM3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human skeletal muscle shows high expression.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PRPF6 Antibody
NBP1-92298
Western Blot: PRPF6 Antibody [NBP1-92298] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: PRPF6 Antibody [NBP1-92298] - Staining of human cell line CACO-2 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining in human fallopian tube and pancreas tissues using anti-PRPF6 antibody. Corresponding PRPF6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CCL27/CTACK [HRP]
DCC270
(10 Publications)
Species: Hu
SLPI [HRP]
DPI00
(28 Publications)
Species: Hu
ATRNL1 Antibody
NBP1-89131
Immunocytochemistry/Immunofluorescence: ATRNL1 Antibody [NBP1-89131] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.
Immunohistochemistry: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FEM1B Antibody
NBP1-77300
Western Blot: FEM1B Antibody [NBP1-77300] - Analysis of FEM1B in mouse (A) and rat (B) liver tissue lysates with anti- FEM1B using this antibody at 1 ug /ml.
Immunohistochemistry-Paraffin: FEM1B Antibody [NBP1-77300] - Mouse liver tissue with FEM1B antibody at 5 ug/ml.
Immunofluorescence: FEM1B Antibody [NBP1-77300] - Staining of F1A alpha in mouse liver tissue with F1A alpha antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
MARCO Antibody
NBP2-39004
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining in human lung and pancreas tissues. Corresponding MARCO RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: MARCO Antibody [NBP2-39004] - Staining of human cell line HeLa shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry: MARCO Antibody [NBP2-39004] - Staining in normal human liver. Image from a verified customer review.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CYP4V2 Antibody
NBP1-85361
Western Blot: CYP4V2 Antibody [NBP1-85361] - Analysis in human cell line SK-MEL-30 and human cell line HeLa.
Immunohistochemistry-Paraffin: CYP4V2 Antibody [NBP1-85361] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: CYP4V2 Antibody [NBP1-85361] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: WB, IHC, IHC-P
NAT10 Antibody
NBP2-32263
Western Blot: NAT10 Antibody [NBP2-32263] - Samples: Whole cell lysate (50 ug) prepared using NETN buffer from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-NAT10 antibody NBP2-32263 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Species: Hu, Mu
Applications: WB, IHC, IP
Clusterin/APOJ
[HRP]
DCLU00
(2 Reviews)
(10 Publications)
Species: Hu
ASRGL1 Antibody
NBP1-89133
Western Blot: ASRGL1 Antibody [NBP1-89133] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: ASRGL1 Antibody [NBP1-89133] - Staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP1-89133] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP1-89133 (A) shows similar protein distribution across tissues to independent antibody NBP2-38759 (B).
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Alkaline
Phosphatase/ALPP Anti ...
NB110-3638
Immunocytochemistry/Immunofluorescence: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - Representative montage images are shown for control dissociated DRG culture. (B) Dissociated DRGs cultures exposed to conditioned medium from alkaline phosphatase-expressing rat GRPs. Image collected and cropped by CiteAb from the following publication (eneuro.org/content/4/1/ENEURO.0171-16.2017), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - IHC staining of Alkaline Phosphatase (Placental) in human placenta using DAB with hematoxylin counterstain. Proteolytic Induced Epitope Retrieval (PIER) was used.
Immunocytochemistry/Immunofluorescence: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - analysis of ALPP in MDA-MB-231 cells using an anti-ALPP antibody (blue - cell membrane, green - ALPP). Image from verified customer review.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Neprilysin/CD10
Antibody (SN75-07)
NBP2-67717
Western Blot: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of CD10 on Daudi cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Staining CD10 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of paraffin-embedded human tonsil tissue using anti-CD10 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ANKRD37 Antibody
NBP1-98583
ANKRD37 Antibody
Species: Hu, Mu, Hu, Rt, Bv, Gt, Gp, Rb
Applications: WB

Publications for ANKRD37 Antibody (NBP1-98583)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ANKRD37 Antibody (NBP1-98583) (0)

There are no reviews for ANKRD37 Antibody (NBP1-98583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD37 Antibody (NBP1-98583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ANKRD37 Products

Bioinformatics Tool for ANKRD37 Antibody (NBP1-98583)

Discover related pathways, diseases and genes to ANKRD37 Antibody (NBP1-98583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD37 Antibody (NBP1-98583)

Discover more about diseases related to ANKRD37 Antibody (NBP1-98583).
 

Pathways for ANKRD37 Antibody (NBP1-98583)

View related products by pathway.

PTMs for ANKRD37 Antibody (NBP1-98583)

Learn more about PTMs related to ANKRD37 Antibody (NBP1-98583).

Blogs on ANKRD37

There are no specific blogs for ANKRD37, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD37 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ANKRD37
Uniprot