ANKRD37 Antibody

Images

 
Western Blot: ANKRD37 Antibody [NBP1-98583] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD37 Antibody Summary

Immunogen
The immunogen for this antibody is Ankrd37 - N-terminal region. Peptide sequence FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKRD37 Antibody

  • ankyrin repeat domain 37
  • ankyrin repeat domain-containing protein 37
  • hLrp2bp
  • low density lipoprotein receptor-related protein binding protein
  • Low-density lipoprotein receptor-related protein 2-binding protein
  • LPR2BP
  • Lrp2bp
  • MGC111507

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
H00002483-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77300
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-39004
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-98583
Species: Mu
Applications: WB

Publications for ANKRD37 Antibody (NBP1-98583) (0)

There are no publications for ANKRD37 Antibody (NBP1-98583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD37 Antibody (NBP1-98583) (0)

There are no reviews for ANKRD37 Antibody (NBP1-98583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD37 Antibody (NBP1-98583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD37 Products

Bioinformatics Tool for ANKRD37 Antibody (NBP1-98583)

Discover related pathways, diseases and genes to ANKRD37 Antibody (NBP1-98583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD37 Antibody (NBP1-98583)

Discover more about diseases related to ANKRD37 Antibody (NBP1-98583).
 

Pathways for ANKRD37 Antibody (NBP1-98583)

View related products by pathway.

PTMs for ANKRD37 Antibody (NBP1-98583)

Learn more about PTMs related to ANKRD37 Antibody (NBP1-98583).

Blogs on ANKRD37

There are no specific blogs for ANKRD37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD37
Uniprot