Reactivity | Hu, Mu, Hu, Rt, Bv, Gt, Gp, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | The immunogen for this antibody is Ankrd37 - N-terminal region. Peptide sequence FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNK. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Human (100%), Rat (100%), Goat (93%), Bovine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ANKRD37 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Theoretical MW | 17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-98583 | Applications | Species |
---|---|---|
Deng M, Zhang W, Lingling Y et al. HIF-1a regulates hypoxia-induced autophagy via translocation of ANKRD37 in colon cancer Exp. Cell Res. Jul 14 2020 [PMID: 32679233] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for ANKRD37 Antibody (NBP1-98583)Discover more about diseases related to ANKRD37 Antibody (NBP1-98583).
| Pathways for ANKRD37 Antibody (NBP1-98583)View related products by pathway.
|
PTMs for ANKRD37 Antibody (NBP1-98583)Learn more about PTMs related to ANKRD37 Antibody (NBP1-98583).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ANKRD37 |
Uniprot |
|