Home » ANKRD37 » ANKRD37 Antibodies » ANKRD37 Antibody

ANKRD37 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ANKRD37 Antibody [NBP1-98583] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.
Western Blot: ANKRD37 Antibody [NBP1-98583] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ANKRD37 Antibody Summary

Immunogen
The immunogen for this antibody is Ankrd37 - N-terminal region. Peptide sequence FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKRD37 Antibody

  • ankyrin repeat domain 37
  • ankyrin repeat domain-containing protein 37
  • hLrp2bp
  • low density lipoprotein receptor-related protein binding protein
  • Low-density lipoprotein receptor-related protein 2-binding protein
  • LPR2BP
  • Lrp2bp
  • MGC111507

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulysin/IDE
Antibody (JJ0949)
NBP2-66907
Western Blot: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of Insulin degrading enzyme on different lysates using anti-Insulin degrading enzyme antibody at 1/1,000 dilution. Positive control: Lane 1: zebrafish Lane 2: Hela Lane 3: K562
Immunohistochemistry-Paraffin: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of paraffin-embedded mouse colon tissue using anti-Insulin degrading enzyme antibody. Counter stained with hematoxylin.
Western Blot: Insulysin/IDE Antibody (JJ0949) [NBP2-66907] - Analysis of Insulin degrading enzyme on hybrid fish (crucian-carp) heart tissue lysate using anti-Insulin degrading enzyme antibody at 1/500 dilution.
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, IHC, IHC-P
LRP2 Antibody
(CD7D5)
NB110-96417
Immunocytochemistry/Immunofluorescence: LRP2 Antibody (CD7D5) [NB110-96417] - Immunofluorescence staining of Megalin in the brush border of the proximal tubule.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Staining (paraffin-embedded tissue-sections fixed in formalin) of Megalin in the brush border of the proximal tubule.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Staining on human kidney at 1:100, overnight incubation at 4C. Image from a review by a confirmed customer.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Adenine Nucleotide
Translocase 1 Antibod ...
NBP1-59594
Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - Sample Tissue: Human RPMI-8226 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Adenine Nucleotide Translocase 1 Antibody [NBP1-59594] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
FRG1 Antibody (4A5)
H00002483-M01
Western Blot: FRG1 Antibody (4A5) [H00002483-M01] - FRG1 monoclonal antibody (M01), clone 4A5 Analysis of FRG1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: FRG1 Antibody (4A5) [H00002483-M01] - Analysis of monoclonal antibody to FRG1 on HeLa cell. Antibody concentration 35 ug/ml.
Western Blot: FRG1 Antibody (4A5) [H00002483-M01] - Analysis of FRG1 expression in transfected 293T cell line by FRG1 monoclonal antibody (M01), clone 4A5.Lane 1: FRG1 transfected lysate(29 KDa).Lane 2: Non-transfected lysate.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
PDLIM3 Antibody
NBP1-89134
Immunocytochemistry/Immunofluorescence: PDLIM3 Antibody [NBP1-89134] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: PDLIM3 Antibody [NBP1-89134] - Staining of human cerebral cortex shows low expression as expected.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PRPF6 Antibody
NBP1-92298
Western Blot: PRPF6 Antibody [NBP1-92298] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: PRPF6 Antibody [NBP1-92298] - Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining in human fallopian tube and pancreas tissues using anti-PRPF6 antibody. Corresponding PRPF6 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATRNL1 Antibody
NBP1-89131
Immunocytochemistry/Immunofluorescence: ATRNL1 Antibody [NBP1-89131] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.
Immunohistochemistry: ATRNL1 Antibody [NBP1-89131] - Staining of human small intestine shows strong cytoplasmic and membranous positivity.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
FEM1B Antibody
NBP1-77300
Western Blot: FEM1B Antibody [NBP1-77300] - Analysis of FEM1B in mouse (A) and rat (B) liver tissue lysates with anti- FEM1B using this antibody at 1 ug /ml.
Immunocytochemistry/Immunofluorescence: FEM1B Antibody [NBP1-77300] - Immunofluorescence of F1A alpha in Mouse Liver cells with F1A alpha antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: FEM1B Antibody [NBP1-77300] - mouse liver tissue with FEM1B antibody at 5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MARCO Antibody
NBP2-39004
Immunocytochemistry/Immunofluorescence: MARCO Antibody [NBP2-39004] - Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining in human lung and pancreas tissues. Corresponding MARCO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human normal liver using anti-MARCO antibody. Image from verified customer review.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CYP4V2 Antibody
(M29-P3B10)
NBP2-50214
Western Blot: CYP4V2 Antibody (M29-P3B10) [NBP2-50214] - Shows detection of an approximately 60 kDa band for CYP4V2.
Immunohistochemistry: CYP4V2 Antibody (M29-P3B10) [NBP2-50214] - Immunohistochemistry was performed on formalin-fixed, paraffin-embedded normal and primary colorectal tumour tissue sections using neat culture supernatants of anti-CYP4V2 (M29-P3B10). Photomicrographs show negative staining of anti-CYP4V2 [M29-P3B10] in normal colon mucosa and strong immunostaining in primary colorectal tumour. Cytoplasmic localisation of CYP4V2 is also observed.
Immunohistochemistry: CYP4V2 Antibody (M29-P3B10) [NBP2-50214] - CYP4V2 neat supernatant.
Species: Hu
Applications: WB, ELISA, IHC
NAT10 Antibody
NBP2-32263
Western Blot: NAT10 Antibody [NBP2-32263] - Samples: Whole cell lysate (50 ug) prepared using NETN buffer from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-NAT10 antibody NBP2-32263 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: NAT10 Antibody [NBP2-32263] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- NAT10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Species: Hu
Applications: WB, IHC, IP
Clusterin/APOJ
Antibody
AF2747
Clusterin was detected in perfusion fixed frozen sections of mouse liver using Goat Anti-Mouse Clusterin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2747) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Clusterin was detected in perfusion fixed frozen sections of mouse intestine using Goat Anti-Mouse Clusterin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2747) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(2 Publications)
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
ASRGL1 Antibody
(CL1679)
NBP2-42378
Western Blot: ASRGL1 Antibody (CL1679) [NBP2-42378] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry: ASRGL1 Antibody (CL1679) [NBP2-42378] - Staining of human liver shows absence of immunoreactivity (negative control).
Immunohistochemistry: ASRGL1 Antibody (CL1679) [NBP2-42378] - Staining of human endometrial cancer shows strong immunoreactivity in tumor cells.
Species: Hu
Applications: WB, IHC, IHC-P
Alkaline
Phosphatase/ALPP Anti ...
NB110-3638
Western Blot: Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - Analysis of Alkaline Phosphatase (Placental) expression in JAR whole cell lysate.
Immunocytochemistry/Immunofluorescence: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - analysis of ALPP in MDA-MB-231 cells using an anti-ALPP antibody (blue - cell membrane, green - ALPP). Image from verified customer review.
Immunohistochemistry-Paraffin: Alkaline Phosphatase, Placental Antibody (8B6) [NB110-3638] - IHC staining of Alkaline Phosphatase (Placental) in human placenta using DAB with hematoxylin counterstain. Proteolytic Induced Epitope Retrieval (PIER) was used.
(1 Review)
(10 Publications)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Neprilysin/CD10
Antibody [Unconjugate
AF1182
Western blot shows lysates of LNCaP human prostate cancer cell line and PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1182) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, Recombinant Mouse Neprilysin (Catalog # 1126-ZN) (5 and 50 ng/lane) and Recombinant Human Neprilysin (CHO-expressed) (Catalog # 1182-ZNC) (5 and 50 ng/lane) were included. Specific bands were detected for Neprilysin/CD10 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neprilysin/CD10 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1182) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
ANKRD37 Antibody
NBP1-98583
ANKRD37 Antibody
Species: Mu
Applications: WB

Publications for ANKRD37 Antibody (NBP1-98583) (0)

There are no publications for ANKRD37 Antibody (NBP1-98583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD37 Antibody (NBP1-98583) (0)

There are no reviews for ANKRD37 Antibody (NBP1-98583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD37 Antibody (NBP1-98583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ANKRD37 Antibody (NBP1-98583)

Discover related pathways, diseases and genes to ANKRD37 Antibody (NBP1-98583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD37 Antibody (NBP1-98583)

Discover more about diseases related to ANKRD37 Antibody (NBP1-98583).
 

Pathways for ANKRD37 Antibody (NBP1-98583)

View related products by pathway.

PTMs for ANKRD37 Antibody (NBP1-98583)

Learn more about PTMs related to ANKRD37 Antibody (NBP1-98583).

Blogs on ANKRD37

There are no specific blogs for ANKRD37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD37 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ANKRD37
Uniprot