Recombinant Human FE65 Protein

Images

 
SDS-Page: Recombinant Human FE65 Protein [H00000322-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FE65 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human APBB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEAS

Protein/Peptide Type
Partial Recombinant Protein
Gene
APBB1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FE65 Protein

  • adaptor protein FE65a2
  • amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
  • amyloid beta A4 precursor protein-binding, family B, member 1
  • Fe65
  • FE65amyloid beta A4 precursor protein-binding family B member 1
  • MGC:9072
  • Protein Fe65
  • RIR
  • stat-like protein

Background

APBB1 - amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
AF3129
Species: Hu
Applications: WB, IHC, IP
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89029
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
H00000322-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for FE65 Partial Recombinant Protein (H00000322-Q02) (0)

There are no publications for FE65 Partial Recombinant Protein (H00000322-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FE65 Partial Recombinant Protein (H00000322-Q02) (0)

There are no reviews for FE65 Partial Recombinant Protein (H00000322-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FE65 Partial Recombinant Protein (H00000322-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FE65 Products

Bioinformatics Tool for FE65 Partial Recombinant Protein (H00000322-Q02)

Discover related pathways, diseases and genes to FE65 Partial Recombinant Protein (H00000322-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FE65 Partial Recombinant Protein (H00000322-Q02)

Discover more about diseases related to FE65 Partial Recombinant Protein (H00000322-Q02).
 

Pathways for FE65 Partial Recombinant Protein (H00000322-Q02)

View related products by pathway.

PTMs for FE65 Partial Recombinant Protein (H00000322-Q02)

Learn more about PTMs related to FE65 Partial Recombinant Protein (H00000322-Q02).
 

Research Areas for FE65 Partial Recombinant Protein (H00000322-Q02)

Find related products by research area.

Blogs on FE65

There are no specific blogs for FE65, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FE65 Antibody
NB110-58360

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FE65 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APBB1