FCRLA/FCRLM1 Antibody - BSA Free

Western Blot: FCRLM1 Antibody [NBP1-69347] - This Anti-FCRLA antibody was used in Western Blot of Fetal lung tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FCRLA/FCRLM1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FCRLA (Fc receptor-like A) The peptide sequence was selected from the middle region of FCRLA. Peptide sequence PTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCRLA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FCRLA/FCRLM1 Antibody - BSA Free

• Fc receptor homolog expressed in B cells (FREB)
• Fc receptor homolog expressed in B-cells
• Fc receptor related protein X
• Fc receptor-like A
• Fc receptor-like and mucin-like 1
• Fc receptor-related protein X
• FCRL1
• FCRLA
• FCRLb
• FCRLc1
• FCRLc2
• FCRLd
• FCRLe
• FCRLFc receptor-like protein
• FCRLM1
• FCRLX
• FcRX
• FREB
• FREBFc receptor-like and mucin-like protein 1
• MGC4595

Background

Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCRLA