FCRL1/FcRH1 Antibody

Images

 
Western Blot: FCRL1 Antibody [NBP1-69316] - This Anti-FCRL1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCRL1/FcRH1 Antibody Summary

Immunogen
Synthetic peptides corresponding to FCRL1(Fc receptor-like 1) The peptide sequence was selected from the N terminal of FCRL1. Peptide sequence MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCRL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCRL1 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FCRL1/FcRH1 Antibody

  • BXMH1
  • CD307a antigen
  • CD307a
  • Fc receptor homolog 1
  • Fc receptor-like 1
  • FcRH1
  • FCRH1DKFZp667O1421
  • FCRL1
  • FcR-like protein 1
  • hIFGP1
  • IFGP family protein 1
  • IFGP1
  • IFGP1Fc receptor-like protein 1
  • Immune receptor translocation-associated protein 5
  • IRTA5
  • IRTA5immunoglobulin superfamily Fc receptor, gp42

Background

FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2048
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2426
Species: Hu
Applications: WB, IHC
AF3126
Species: Hu
Applications: Flow, CyTOF-ready
MAB7905
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2087
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-45549
Species: Hu
Applications: WB, Flow, IHC
AF4705
Species: Hu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-84590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-69316
Species: Hu
Applications: WB

Publications for FCRL1/FcRH1 Antibody (NBP1-69316) (0)

There are no publications for FCRL1/FcRH1 Antibody (NBP1-69316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRL1/FcRH1 Antibody (NBP1-69316) (0)

There are no reviews for FCRL1/FcRH1 Antibody (NBP1-69316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRL1/FcRH1 Antibody (NBP1-69316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCRL1/FcRH1 Products

Bioinformatics Tool for FCRL1/FcRH1 Antibody (NBP1-69316)

Discover related pathways, diseases and genes to FCRL1/FcRH1 Antibody (NBP1-69316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRL1/FcRH1 Antibody (NBP1-69316)

Discover more about diseases related to FCRL1/FcRH1 Antibody (NBP1-69316).
 

Pathways for FCRL1/FcRH1 Antibody (NBP1-69316)

View related products by pathway.

Blogs on FCRL1/FcRH1

There are no specific blogs for FCRL1/FcRH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCRL1/FcRH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCRL1
Entrez
Uniprot