FCER1G Antibody - Azide and BSA Free

Western Blot: FCER1G Antibody [NBP3-04822] - Analysis of extracts of mouse spleen, using FCER1G antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FCER1G Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1). LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCER1G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000-1:2000
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for FCER1G Antibody - Azide and BSA Free

• Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
• Fc-epsilon RI-gamma
• FceRI gamma
• FCRG
• high affinity immunoglobulin epsilon receptor subunit gamma
• IgE Fc receptor subunit gamma
• immunoglobulin E receptor, high affinity, gamma chain

Background

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha,1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: FCER1G