FCER1G Antibody


Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human spleen shows strong membranous and cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human cerebral cortex shows moderate membranous and cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FCER1G Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Specificity of human FCER1G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCER1G Protein (NBP1-85959PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FCER1G Antibody

  • Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
  • Fc-epsilon RI-gamma
  • FceRI gamma
  • FCRG
  • high affinity immunoglobulin epsilon receptor subunit gamma
  • IgE Fc receptor subunit gamma
  • immunoglobulin E receptor, high affinity, gamma chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FCER1G Antibody (NBP1-85959) (0)

There are no publications for FCER1G Antibody (NBP1-85959).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCER1G Antibody (NBP1-85959) (0)

There are no reviews for FCER1G Antibody (NBP1-85959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FCER1G Antibody (NBP1-85959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FCER1G Products

Bioinformatics Tool for FCER1G Antibody (NBP1-85959)

Discover related pathways, diseases and genes to FCER1G Antibody (NBP1-85959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCER1G Antibody (NBP1-85959)

Discover more about diseases related to FCER1G Antibody (NBP1-85959).

Pathways for FCER1G Antibody (NBP1-85959)

View related products by pathway.

PTMs for FCER1G Antibody (NBP1-85959)

Learn more about PTMs related to FCER1G Antibody (NBP1-85959).

Blogs on FCER1G

There are no specific blogs for FCER1G, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FCER1G Antibody and receive a gift card or discount.


Gene Symbol FCER1G