FCER1G Antibody

Images

 
Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCER1G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCER1G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCER1G Protein (NBP1-85959PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCER1G Antibody

  • Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
  • Fc-epsilon RI-gamma
  • FceRI gamma
  • FCRG
  • high affinity immunoglobulin epsilon receptor subunit gamma
  • IgE Fc receptor subunit gamma
  • immunoglobulin E receptor, high affinity, gamma chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB1633
Species: Mu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85959
Species: Hu
Applications: IHC, IHC-P

Publications for FCER1G Antibody (NBP1-85959) (0)

There are no publications for FCER1G Antibody (NBP1-85959).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCER1G Antibody (NBP1-85959) (0)

There are no reviews for FCER1G Antibody (NBP1-85959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FCER1G Antibody (NBP1-85959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCER1G Products

Bioinformatics Tool for FCER1G Antibody (NBP1-85959)

Discover related pathways, diseases and genes to FCER1G Antibody (NBP1-85959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCER1G Antibody (NBP1-85959)

Discover more about diseases related to FCER1G Antibody (NBP1-85959).
 

Pathways for FCER1G Antibody (NBP1-85959)

View related products by pathway.

PTMs for FCER1G Antibody (NBP1-85959)

Learn more about PTMs related to FCER1G Antibody (NBP1-85959).

Blogs on FCER1G

There are no specific blogs for FCER1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCER1G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCER1G