FCER1G Antibody - BSA Free

Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human spleen shows strong membranous and cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human cerebral cortex shows moderate membranous and cytoplasmic positivity in glial cells.

Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: FCER1G Antibody [NBP1-85959] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCER1G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FCER1G Antibody - BSA Free (NBP1-85959) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCER1G
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FCER1G Protein (NBP1-85959PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FCER1G Antibody - BSA Free

• Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
• Fc-epsilon RI-gamma
• FceRI gamma
• FCRG
• high affinity immunoglobulin epsilon receptor subunit gamma
• IgE Fc receptor subunit gamma
• immunoglobulin E receptor, high affinity, gamma chain

Background

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha,1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCER1G