Recombinant Human FBXW11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXW11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-529 of Human FBXW11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FBXW11

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXW11 Protein

  • beta-transducin repeat-containing protein 2
  • BTRC2F-box/WD repeat-containing protein 1B
  • BTRCP2FBW1B
  • F-box and WD repeat domain containing 11
  • F-box and WD-40 domain protein 11
  • F-box and WD-40 domain protein 1B
  • F-box protein Fbw1b
  • F-box/WD repeat-containing protein 11
  • Fbw11
  • FBXW1BFbw1b
  • Homologous to Slimb protein
  • Hos
  • KIAA0696F-box and WD repeats protein beta-TrCP2

Background

FBXW11( AAH26213, 1 a.a. - 530 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00023291-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FBXW11 Recombinant Protein (H00023291-P01) (0)

There are no publications for FBXW11 Recombinant Protein (H00023291-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXW11 Recombinant Protein (H00023291-P01) (0)

There are no reviews for FBXW11 Recombinant Protein (H00023291-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXW11 Recombinant Protein (H00023291-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXW11 Products

Bioinformatics Tool for FBXW11 Recombinant Protein (H00023291-P01)

Discover related pathways, diseases and genes to FBXW11 Recombinant Protein (H00023291-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXW11 Recombinant Protein (H00023291-P01)

Discover more about diseases related to FBXW11 Recombinant Protein (H00023291-P01).
 

Pathways for FBXW11 Recombinant Protein (H00023291-P01)

View related products by pathway.

PTMs for FBXW11 Recombinant Protein (H00023291-P01)

Learn more about PTMs related to FBXW11 Recombinant Protein (H00023291-P01).
 

Research Areas for FBXW11 Recombinant Protein (H00023291-P01)

Find related products by research area.

Blogs on FBXW11

There are no specific blogs for FBXW11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXW11 Antibody
NBP2-16454

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXW11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW11