FBXO4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXO4 Antibody [NBP2-58623] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXO4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXO4 Recombinant Protein Antigen (NBP2-58623PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FBXO4 Antibody

  • DKFZp547N213
  • F-box protein 4
  • F-box protein Fbx4
  • FBX4F-box only protein 4
  • FLJ10141

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF6817
Species: Hu
Applications: WB
NBP2-58623
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for FBXO4 Antibody (NBP2-58623) (0)

There are no publications for FBXO4 Antibody (NBP2-58623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO4 Antibody (NBP2-58623) (0)

There are no reviews for FBXO4 Antibody (NBP2-58623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXO4 Antibody (NBP2-58623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO4 Products

Bioinformatics Tool for FBXO4 Antibody (NBP2-58623)

Discover related pathways, diseases and genes to FBXO4 Antibody (NBP2-58623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO4 Antibody (NBP2-58623)

Discover more about diseases related to FBXO4 Antibody (NBP2-58623).
 

Pathways for FBXO4 Antibody (NBP2-58623)

View related products by pathway.

PTMs for FBXO4 Antibody (NBP2-58623)

Learn more about PTMs related to FBXO4 Antibody (NBP2-58623).

Blogs on FBXO4

There are no specific blogs for FBXO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO4