FBXO4 Antibody (NBP2-58623)


Immunocytochemistry/ Immunofluorescence: FBXO4 Antibody [NBP2-58623] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

FBXO4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXO4 Recombinant Protein Antigen (NBP2-58623PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FBXO4 Antibody

  • DKFZp547N213
  • F-box protein 4
  • F-box protein Fbx4
  • FBX4F-box only protein 4
  • FLJ10141


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, GS, ICC/IF
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for FBXO4 Antibody (NBP2-58623) (0)

There are no publications for FBXO4 Antibody (NBP2-58623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO4 Antibody (NBP2-58623) (0)

There are no reviews for FBXO4 Antibody (NBP2-58623). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXO4 Antibody (NBP2-58623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FBXO4 Products

Related Products by Gene

Bioinformatics Tool for FBXO4 Antibody (NBP2-58623)

Discover related pathways, diseases and genes to FBXO4 Antibody (NBP2-58623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO4 Antibody (NBP2-58623)

Discover more about diseases related to FBXO4 Antibody (NBP2-58623).

Pathways for FBXO4 Antibody (NBP2-58623)

View related products by pathway.

PTMs for FBXO4 Antibody (NBP2-58623)

Learn more about PTMs related to FBXO4 Antibody (NBP2-58623).

Blogs on FBXO4

There are no specific blogs for FBXO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FBXO4 Antibody and receive a gift card or discount.


Gene Symbol FBXO4