Recombinant Human FATE1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FATE1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 100 of Human FATE1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FATE1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FATE1 Protein

  • Cancer/testis antigen 43
  • CT43BJ-HCC-2 antigen
  • FATEfetal and adult testis expressed transcript protein
  • fetal and adult testis expressed 1
  • fetal and adult testis-expressed transcript protein
  • Tumor antigen BJ-HCC-2

Background

FATE1 - fetal and adult testis expressed 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP2-01761
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00089885-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FATE1 Partial Recombinant Protein (H00089885-Q01) (0)

There are no publications for FATE1 Partial Recombinant Protein (H00089885-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATE1 Partial Recombinant Protein (H00089885-Q01) (0)

There are no reviews for FATE1 Partial Recombinant Protein (H00089885-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FATE1 Partial Recombinant Protein (H00089885-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FATE1 Products

Bioinformatics Tool for FATE1 Partial Recombinant Protein (H00089885-Q01)

Discover related pathways, diseases and genes to FATE1 Partial Recombinant Protein (H00089885-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FATE1 Partial Recombinant Protein (H00089885-Q01)

Discover more about diseases related to FATE1 Partial Recombinant Protein (H00089885-Q01).
 

Pathways for FATE1 Partial Recombinant Protein (H00089885-Q01)

View related products by pathway.

Blogs on FATE1

There are no specific blogs for FATE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FATE1 Antibody
NBP1-85402

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FATE1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FATE1