Fas/TNFRSF6/CD95 Antibody


Western Blot: Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & cytosol. Antibody staining is ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Staining in human rectum and skeletal muscle tissues using anti-FAS antibody. Corresponding FAS RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NBP1-89034] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Fas/TNFRSF6/CD95 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Specificity of human Fas/TNFRSF6/CD95 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Fas/TNFRSF6/CD95 Lysate (NBP2-65113)
Control Peptide
Fas/TNFRSF6/CD95 Protein (NBP1-89034PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Fas/TNFRSF6/CD95 Antibody

  • Apo-1 antigen
  • Apo-1
  • apoptosis antigen 1
  • Apoptosis-mediating surface antigen FAS
  • APT1
  • CD95 antigen
  • CD95
  • CD95ALPS1A
  • Fas (TNF receptor superfamily, member 6)
  • Fas AMA
  • Fas antigen
  • Fas
  • FAS1
  • FASLG receptor
  • TNFRSF6member 6
  • tumor necrosis factor receptor superfamily member 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fas/TNFRSF6/CD95 Antibody (NBP1-89034) (0)

There are no publications for Fas/TNFRSF6/CD95 Antibody (NBP1-89034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fas/TNFRSF6/CD95 Antibody (NBP1-89034) (0)

There are no reviews for Fas/TNFRSF6/CD95 Antibody (NBP1-89034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Fas/TNFRSF6/CD95 Antibody (NBP1-89034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Fas/TNFRSF6/CD95 Products

Bioinformatics Tool for Fas/TNFRSF6/CD95 Antibody (NBP1-89034)

Discover related pathways, diseases and genes to Fas/TNFRSF6/CD95 Antibody (NBP1-89034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fas/TNFRSF6/CD95 Antibody (NBP1-89034)

Discover more about diseases related to Fas/TNFRSF6/CD95 Antibody (NBP1-89034).

Pathways for Fas/TNFRSF6/CD95 Antibody (NBP1-89034)

View related products by pathway.

PTMs for Fas/TNFRSF6/CD95 Antibody (NBP1-89034)

Learn more about PTMs related to Fas/TNFRSF6/CD95 Antibody (NBP1-89034).

Blogs on Fas/TNFRSF6/CD95

There are no specific blogs for Fas/TNFRSF6/CD95, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fas/TNFRSF6/CD95 Antibody and receive a gift card or discount.


Gene Symbol FAS