FANCF Antibody (3C4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: FANCF Antibody (3C4) [H00002188-M03] - Analysis of monoclonal antibody to FANCF on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: FANCF Antibody (3C4) [H00002188-M03] - Detection limit for recombinant GST tagged FANCF is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 3C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FANCF Antibody (3C4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FANCF (NP_073562.1, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDV
• Specificity: Reacts with Fanconi anemia, complementation group F.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FANCF
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FANCF Antibody (3C4) - Azide and BSA Free

• FAF
• Fanconi anemia group F protein
• Fanconi anemia, complementation group F
• MGC126856
• Protein FACF

Background

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FANCF
• Entrez:
  • 2188(Human)
• Uniprot:
  • NP_073562(Human)