FAM50A Antibody

Western Blot: FAM50A Antibody [NBP1-89344] - Analysis in human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: FAM50A Antibody [NBP1-89344] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human prostate shows strong nuclear/ cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human cerebral cortex strong nuclear/cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

• Reactivity: Hu, Ze, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM50A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM50A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IP reported in scientific publication (PMID: 32703943).
• Control Peptide:

  FAM50A Protein (NBP1-89344PEP)

Reactivity Notes

Use in Zebrafish reported in scientific publication (PMID: 32703943).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM50A Antibody

• DXS9928EXAP-5 protein
• family with sequence similarity 50, member A
• HXC-26
• Protein HXC-26
• Protein XAP-5
• XAP5HXC26,9F

Background

The FAM50A gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM50A Antibody (NBP1-89344)(2)

Publications using NBP1-89344

• Lee YR, Khan K, Armfield-Uhas K et al. Mutations in FAM50A suggest that Armfield XLID syndrome is a spliceosomopathy Nat Commun 2020-07-23 [PMID: 32703943] (IP, WB, ICC/IF, Zebrafish, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: FAM50A