FAM50A Antibody

Images

 
Western Blot: FAM50A Antibody [NBP1-89344] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: FAM50A Antibody [NBP1-89344] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Western Blot: FAM50A Antibody [NBP1-89344] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM50A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM50A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM50A Protein (NBP1-89344PEP)
Publications
Read Publication using NBP1-89344.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM50A Antibody

  • DXS9928EXAP-5 protein
  • family with sequence similarity 50, member A
  • HXC-26
  • Protein HXC-26
  • Protein XAP-5
  • XAP5HXC26,9F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-06677
Species: Hu
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB5657
Species: Hu
Applications: WB, IP, ICC
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB8494
Species: Hu
Applications: WB, IHC, ICC
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83059
Species: Hu
Applications: IHC, IHC-P
NBP1-52926
Species: Hu
Applications: WB
NBP1-89344
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM50A Antibody (NBP1-89344)(1)

Reviews for FAM50A Antibody (NBP1-89344) (0)

There are no reviews for FAM50A Antibody (NBP1-89344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM50A Antibody (NBP1-89344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM50A Products

Bioinformatics Tool for FAM50A Antibody (NBP1-89344)

Discover related pathways, diseases and genes to FAM50A Antibody (NBP1-89344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM50A Antibody (NBP1-89344)

Discover more about diseases related to FAM50A Antibody (NBP1-89344).
 

Pathways for FAM50A Antibody (NBP1-89344)

View related products by pathway.

Blogs on FAM50A

There are no specific blogs for FAM50A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM50A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM50A