FAM50A Antibody

Images

 
Western Blot: FAM50A Antibody [NBP1-89344] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: FAM50A Antibody [NBP1-89344] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry: FAM50A Antibody [NBP1-89344] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human cerebral cortex strong nuclear/cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, Rt, ZeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM50A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Specificity
Specificity of human FAM50A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM50A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunoprecipitation
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IP reported in secitific publication PMID: 32703943
Control Peptide
FAM50A Protein (NBP1-89344PEP)
Publications
Read Publications using
NBP1-89344 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261) Use in Zebrafish reported in secitific publication PMID: 32703943

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM50A Antibody

  • DXS9928EXAP-5 protein
  • family with sequence similarity 50, member A
  • HXC-26
  • Protein HXC-26
  • Protein XAP-5
  • XAP5HXC26,9F

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054716-M02
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-13249
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13249
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
H00008994-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-97655
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57749
Species: Hu
Applications: ICC/IF
H00002770-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-89344
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for FAM50A Antibody (NBP1-89344)(2)

We have publications tested in 2 confirmed species: Human, Zebrafish.

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Zebrafish
(1)
All Species

Reviews for FAM50A Antibody (NBP1-89344) (0)

There are no reviews for FAM50A Antibody (NBP1-89344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM50A Antibody (NBP1-89344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM50A Products

Bioinformatics Tool for FAM50A Antibody (NBP1-89344)

Discover related pathways, diseases and genes to FAM50A Antibody (NBP1-89344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM50A Antibody (NBP1-89344)

Discover more about diseases related to FAM50A Antibody (NBP1-89344).
 

Pathways for FAM50A Antibody (NBP1-89344)

View related products by pathway.

Blogs on FAM50A

There are no specific blogs for FAM50A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM50A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM50A