FAM50A Antibody - BSA Free

Western Blot: FAM50A Antibody [NBP1-89344] - Analysis in human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: FAM50A Antibody [NBP1-89344] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human prostate shows strong nuclear/ cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human cerebral cortex strong nuclear/cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Western Blot: FAM50A Antibody [NBP1-89344] - FAM50A interacts with U5 & C-complex proteins.a Schematic representation of the two-step splicing reaction (adapted from ref. 70). EFTUD2 (U5); FAM50A & DDX41 (C-complex). b Graphical representation of semi-native co-immunoprecipitation assay. Candidate interactors were overexpressed in U-87 cells, harvested in immunoprecipitation (IP) lysis buffer at 60 h post-transfection & immunoprecipitated with anti-FAM50A antibody. The interaction partners were detected in IP lysate using anti-V5 & anti-FAM50A antibodies, respectively. c, d Western blot of proteins after co-immunoprecipitation. Top: total protein lysate input (50 μg/lane) was migrated on 4–15% polyacrylamide gels to detect EFTUD2 (c) or DDX41 (d) using anti-V5 mouse monoclonal antibody. GAPDH was used as loading control. Bottom: Anti-FAM50A antibody was used to immunoprecipitate native FAM50A protein in total input lysate of 2.3 mg/condition (c) or 3.5 mg/condition (d). The IP lysate was separated in two parts (20% & 80%) & migrated independently on 4–15% polyacrylamide gels. The proteins of interest with predicated band sizes are indicated with black arrows. Plus & minus signs indicate presence & absence of relevant plasmids, respectively. EFTUD2 & DDX41 were detected in independent experiments using protein lysates derived from replicate batches of U-87 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32703943), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Ze, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM50A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM50A Antibody - BSA Free (NBP1-89344) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-FAM50A Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM50A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation Reported in scientific publication (PMID: 32703943)
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM50A Protein (NBP1-89344PEP)

Reactivity Notes

Use in Zebrafish reported in scientific publication (PMID: 32703943).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM50A Antibody - BSA Free

• DXS9928EXAP-5 protein
• family with sequence similarity 50, member A
• HXC-26
• Protein HXC-26
• Protein XAP-5
• XAP5HXC26,9F

Background

The FAM50A gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM50A Antibody (NBP1-89344)(2)

Publications using NBP1-89344

• Lee YR, Khan K, Armfield-Uhas K et al. Mutations in FAM50A suggest that Armfield XLID syndrome is a spliceosomopathy Nat Commun 2020-07-23 [PMID: 32703943] (IP, WB, ICC/IF, Zebrafish, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: FAM50A