Recombinant Human FAM3D Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FAM3D Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 26 - 224 of Human FAM3D full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTLCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FAM3D

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAM3D Protein

  • cytokine-like protein EF-7
  • EF7
  • FAM3D
  • family with sequence similarity 3, member D
  • OIT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-1888
Species: Hu, Mu, Rt
Applications: WB, IHC, PEP-ELISA
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF3080
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-32841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76514
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00054097-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF2865
Species: Hu
Applications: WB
NBP1-92201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00131177-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FAM3D Recombinant Protein (H00131177-P01) (0)

There are no publications for FAM3D Recombinant Protein (H00131177-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3D Recombinant Protein (H00131177-P01) (0)

There are no reviews for FAM3D Recombinant Protein (H00131177-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM3D Recombinant Protein (H00131177-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM3D Products

Bioinformatics Tool for FAM3D Recombinant Protein (H00131177-P01)

Discover related pathways, diseases and genes to FAM3D Recombinant Protein (H00131177-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3D Recombinant Protein (H00131177-P01)

Discover more about diseases related to FAM3D Recombinant Protein (H00131177-P01).
 

Pathways for FAM3D Recombinant Protein (H00131177-P01)

View related products by pathway.

Research Areas for FAM3D Recombinant Protein (H00131177-P01)

Find related products by research area.

Blogs on FAM3D

There are no specific blogs for FAM3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAM3D Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM3D
Entrez