FAM3B Antibody

Images

 
Western Blot: FAM3B Antibody [H00054097-D01P] - Analysis of FAM3B expression in mouse intestine.
Western Blot: FAM3B Antibody [H00054097-D01P] - Analysis of FAM3B expression in transfected 293T cell line by FAM3B polyclonal antibody.Lane 1: FAM3B transfected lysate(26.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related FAM3B Primary Antibodies

Order Details


    • Catalog Number
      H00054097-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FAM3B Antibody Summary

Immunogen
FAM3B (NP_478066.3, 1 a.a. - 235 a.a.) full-length human protein. MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Specificity
Reacts with family with sequence similarity 3, member B.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM3B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAM3B Antibody

  • 2-21
  • C21orf11
  • C21orf76PANDER
  • chromosome 21 open reading frame 11
  • Cytokine-like protein 2-21
  • D21M16SJHU19e
  • FAM3B
  • family with sequence similarity 3, member B
  • ORF9
  • pancreatic derived factor
  • Pancreatic-derived factor
  • PANDER
  • PRED44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-16001
Species: V
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FAM3B Antibody (H00054097-D01P) (0)

There are no publications for FAM3B Antibody (H00054097-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM3B Antibody (H00054097-D01P) (0)

There are no reviews for FAM3B Antibody (H00054097-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM3B Antibody (H00054097-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM3B Products

Bioinformatics Tool for FAM3B Antibody (H00054097-D01P)

Discover related pathways, diseases and genes to FAM3B Antibody (H00054097-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM3B Antibody (H00054097-D01P)

Discover more about diseases related to FAM3B Antibody (H00054097-D01P).
 

Pathways for FAM3B Antibody (H00054097-D01P)

View related products by pathway.

PTMs for FAM3B Antibody (H00054097-D01P)

Learn more about PTMs related to FAM3B Antibody (H00054097-D01P).
 

Research Areas for FAM3B Antibody (H00054097-D01P)

Find related products by research area.

Blogs on FAM3B

There are no specific blogs for FAM3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM3B
Entrez
Uniprot