FAM189B Antibody

Images

 
Western Blot: FAM189B Antibody [NBP1-88343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: FAM189B Antibody [NBP1-88343] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAM189B Antibody [NBP1-88343] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
Western Blot: FAM189B Antibody [NBP1-88343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM189B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAPDPSGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM189B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM189B Protein (NBP1-88343PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM189B Antibody

  • C1orf2
  • chromosome 1 open reading frame 2
  • cote1
  • family with sequence similarity 189, member B
  • hypothetical protein LOC10712
  • Protein COTE1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP1-79765
Species: Mu
Applications: WB
AF5344
Species: Hu, Mu
Applications: WB
NBP2-47506
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM189B Antibody (NBP1-88343) (0)

There are no publications for FAM189B Antibody (NBP1-88343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM189B Antibody (NBP1-88343) (0)

There are no reviews for FAM189B Antibody (NBP1-88343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM189B Antibody (NBP1-88343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM189B Products

Bioinformatics Tool for FAM189B Antibody (NBP1-88343)

Discover related pathways, diseases and genes to FAM189B Antibody (NBP1-88343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM189B

There are no specific blogs for FAM189B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM189B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM189B