![Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human skeletal muscle shows strong cytoplasmic and nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/FAM168B-Antibody-Immunohistochemistry-Paraffin-NBP1-93650-img0001.jpg "Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human skeletal muscle shows strong cytoplasmic and nuclear positivity in myocytes.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FAM168B Antibody - BSA Free (NBP1-93650) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM168B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM168B |
![Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human heart muscle, kidney, lymph node and skeletal muscle using Anti-FAM168B antibody NBP1-93650 (A) shows similar protein distribution across tissues to independent antibody NBP2-49343 (B).](http://images.novusbio.com/fullsize/FAM168B-Antibody-Immunohistochemistry-Paraffin-NBP1-93650-img0002.jpg "Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human heart muscle, kidney, lymph node and skeletal muscle using Anti-FAM168B antibody NBP1-93650 (A) shows similar protein distribution across tissues to independent antibody NBP2-49343 (B).")
![Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human kidney.](http://images.novusbio.com/fullsize/FAM168B-Antibody-Immunohistochemistry-Paraffin-NBP1-93650-img0003.jpg "Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human skeletal muscle.](http://images.novusbio.com/fullsize/FAM168B-Antibody-Immunohistochemistry-Paraffin-NBP1-93650-img0004.jpg "Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human skeletal muscle.")
![Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human heart muscle.](http://images.novusbio.com/fullsize/FAM168B-Antibody-Immunohistochemistry-Paraffin-NBP1-93650-img0006.jpg "Immunohistochemistry-Paraffin: FAM168B Antibody [NBP1-93650] - Staining of human heart muscle.")
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")