FAM13B1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FAM13B1 Antibody [NBP1-90810] - Staining of human testis shows strong cytoplasmic positivity in subsets of cells in seminiferus ducts.

Staining of human placenta shows moderate cytoplasmic positivity in decidual cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neurons.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM13B1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM13B1 Antibody - BSA Free (NBP1-90810) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KNLQQQSVVCNNEAESIHCDGEGSNNQIDIADDIINASESNRDCSKPVASTNLDNEAMQQDCVFENEENTQSVG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM13B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM13B1 Protein (NBP1-90810PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM13B1 Antibody - BSA Free

• C5orf5
• chromosome 5 open reading frame 5
• DKFZp667F249
• FAM13B1
• family with sequence similarity 13, member B
• family with sequence similarity 13, member B1
• FLJ26735
• GAP-like protein N61
• hypothetical protein LOC51306
• KHCHP
• MGC57159
• N61

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM13B