FAM13A Antibody


Immunocytochemistry/ Immunofluorescence: FAM13A Antibody [NBP1-88825] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & cell junctions.
Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FAM13A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFE
Specificity of human FAM13A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM13A Protein (NBP1-88825PEP)
Read Publication using
NBP1-88825 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%). Human reactivity reported in scientific literature (PMID: 25609086).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM13A Antibody

  • ARHGAP48
  • FAM13A1
  • FAM13A1_v2 protein
  • family with sequence similarity 13, member A
  • KIAA0914
  • member A1
  • MGC105131


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, Flow
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA

Publications for FAM13A Antibody (NBP1-88825)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for FAM13A Antibody (NBP1-88825) (0)

There are no reviews for FAM13A Antibody (NBP1-88825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM13A Antibody (NBP1-88825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM13A Products

Bioinformatics Tool for FAM13A Antibody (NBP1-88825)

Discover related pathways, diseases and genes to FAM13A Antibody (NBP1-88825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM13A Antibody (NBP1-88825)

Discover more about diseases related to FAM13A Antibody (NBP1-88825).

Pathways for FAM13A Antibody (NBP1-88825)

View related products by pathway.

Blogs on FAM13A

There are no specific blogs for FAM13A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM13A Antibody and receive a gift card or discount.


Gene Symbol FAM13A