FAM13A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM13A Antibody [NBP1-88825] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM13A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM13A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
WB reported in scientific literature (PMID: 25609086). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM13A Protein (NBP1-88825PEP)
Publications
Read Publication using
NBP1-88825 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%). Human reactivity reported in scientific literature (PMID: 25609086).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM13A Antibody

  • ARHGAP48
  • FAM13A1
  • FAM13A1_v2 protein
  • family with sequence similarity 13, member A
  • KIAA0914
  • member A1
  • MGC105131

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1568
Species: Mu
Applications: WB
NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP2-61673
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-93967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-61677
Species: Hu, Rt
Applications: WB, ELISA, Flow
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP3-04894
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98506
Species: Mu
Applications: WB
AF1007
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF6394
Species: Hu
Applications: WB, IP
NBP1-72115
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-508
Species: Hu, Mu, Rt, Ha
Applications: WB, IP
NBP2-38594
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68751
Species: Hu
Applications: IHC, IHC-P

Publications for FAM13A Antibody (NBP1-88825)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FAM13A Antibody (NBP1-88825) (0)

There are no reviews for FAM13A Antibody (NBP1-88825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM13A Antibody (NBP1-88825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM13A Products

Bioinformatics Tool for FAM13A Antibody (NBP1-88825)

Discover related pathways, diseases and genes to FAM13A Antibody (NBP1-88825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM13A Antibody (NBP1-88825)

Discover more about diseases related to FAM13A Antibody (NBP1-88825).
 

Pathways for FAM13A Antibody (NBP1-88825)

View related products by pathway.

Blogs on FAM13A

There are no specific blogs for FAM13A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM13A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM13A