FAM13A Antibody

Immunocytochemistry/Immunofluorescence: FAM13A Antibody [NBP1-88825] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FAM13A Antibody [NBP1-88825] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM13A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM13A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25609086). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM13A Protein (NBP1-88825PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM13A Antibody

• ARHGAP48
• FAM13A1
• FAM13A1_v2 protein
• family with sequence similarity 13, member A
• KIAA0914
• member A1
• MGC105131

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM13A Antibody (NBP1-88825)(1)

Publication using NBP1-88825

• Jin Z, Chung JW, Mei W et al. Regulation of nuclear-cytoplasmic shuttling and function of Family with sequence similarity 13, member A (Fam13a), by B56-containing PP2As and Akt. Mol Biol Cell 2015-03-15 [PMID: 25609086] (WB, Human)

Bioinformatics

• Gene Symbol: FAM13A