FAM122A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM122A Antibody [NBP2-31646] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: FAM122A Antibody [NBP2-31646] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM122A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM122A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM122A Protein (NBP2-31646PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM122A Antibody

  • C9orf42
  • chromosome 9 open reading frame 42
  • family with sequence similarity 122A
  • hypothetical protein LOC116224
  • MGC17347

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42216
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2958
Species: Hu
Applications: WB
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026263-M01
Species: Hu
Applications: WB, ELISA
NBP2-16216
Species: Hu, Mu
Applications: WB
NB100-97823
Species: Hu
Applications: WB, ICC/IF, IP
NB100-1070
Species: Hu, Mu
Applications: WB, ELISA
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
E2-745
Species: Hu
MAB5175
Species: Mu
Applications: WB, IHC
NBP2-31646
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FAM122A Antibody (NBP2-31646) (0)

There are no publications for FAM122A Antibody (NBP2-31646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM122A Antibody (NBP2-31646) (0)

There are no reviews for FAM122A Antibody (NBP2-31646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM122A Antibody (NBP2-31646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM122A Products

Bioinformatics Tool for FAM122A Antibody (NBP2-31646)

Discover related pathways, diseases and genes to FAM122A Antibody (NBP2-31646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM122A Antibody (NBP2-31646)

Discover more about diseases related to FAM122A Antibody (NBP2-31646).
 

Pathways for FAM122A Antibody (NBP2-31646)

View related products by pathway.

Blogs on FAM122A

There are no specific blogs for FAM122A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM122A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM122A
Uniprot