FAM101B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM101B Antibody [NBP2-30519] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemistry: FAM101B Antibody [NBP2-30519] - Staining of human kidney shows strong cytoplasmic and luminal membrane positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM101B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM101B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM101B Protein (NBP2-30519PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM101B Antibody

  • Family With Sequence Similarity 101, Member B
  • Protein FAM101B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20024
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59021
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56495
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45505
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-30519
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FAM101B Antibody (NBP2-30519) (0)

There are no publications for FAM101B Antibody (NBP2-30519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM101B Antibody (NBP2-30519) (0)

There are no reviews for FAM101B Antibody (NBP2-30519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM101B Antibody (NBP2-30519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM101B Products

FAM101B NBP2-30519

Bioinformatics Tool for FAM101B Antibody (NBP2-30519)

Discover related pathways, diseases and genes to FAM101B Antibody (NBP2-30519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM101B Antibody (NBP2-30519)

Discover more about diseases related to FAM101B Antibody (NBP2-30519).
 

Pathways for FAM101B Antibody (NBP2-30519)

View related products by pathway.

Blogs on FAM101B

There are no specific blogs for FAM101B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM101B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM101B
Uniprot