TOX4 Antibody

Images

 
Western Blot: TOX4 Antibody [NBP1-88433] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: TOX4 Antibody [NBP1-88433] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TOX4 Antibody [NBP1-88433] - Staining of human urinary bladder shows nuclear positivity in urothelial cells.
Western Blot: TOX4 Antibody [NBP1-88433] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOX4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MQQPPPQKVRINLQQQPPPLQIKSVPLPTLKMQTTLVPPTVESSPERPMNNSPEAHTVEAPSPETICEMITDVVPEVESPSQMDVELVSGSPVALSPQPRCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOX4 Protein (NBP1-88433PEP)
Publications
Read Publication using NBP1-88433.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24312278)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOX4 Antibody

  • C14orf92
  • chromosome 14 open reading frame 92
  • Epidermal Langerhans cell protein LCP1
  • KIAA0737MIG7
  • LCP1
  • migration-inducing protein 7
  • TOX high mobility group box family member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF21581
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57428
Species: Hu
Applications: WB, ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP1-88433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOX4 Antibody (NBP1-88433)(1)

Reviews for TOX4 Antibody (NBP1-88433) (0)

There are no reviews for TOX4 Antibody (NBP1-88433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOX4 Antibody (NBP1-88433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOX4 Products

Bioinformatics Tool for TOX4 Antibody (NBP1-88433)

Discover related pathways, diseases and genes to TOX4 Antibody (NBP1-88433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOX4 Antibody (NBP1-88433)

Discover more about diseases related to TOX4 Antibody (NBP1-88433).
 

Pathways for TOX4 Antibody (NBP1-88433)

View related products by pathway.

PTMs for TOX4 Antibody (NBP1-88433)

Learn more about PTMs related to TOX4 Antibody (NBP1-88433).

Blogs on TOX4

There are no specific blogs for TOX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOX4