FAIM2 Antibody - BSA Free

Western Blot: FAIM2 Antibody [NBP2-33537] - Analysis in control (vector only transfected HEK293T lysate) and FAIM2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: FAIM2 Antibody [NBP2-33537] - Staining of human lymph node.

Immunohistochemistry-Paraffin: FAIM2 Antibody [NBP2-33537] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: FAIM2 Antibody [NBP2-33537] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: FAIM2 Antibody [NBP2-33537] - Staining in human cerebral cortex and pancreas tissues using anti-FAIM2 antibody. Corresponding FAIM2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FAIM2 Antibody [NBP2-33537] - Staining of human cerebral cortex, kidney, lymph node and pancreas using Anti-FAIM2 antibody NBP2-33537 (A) shows similar protein distribution across tissues to independent antibody NBP1-81456 (B).

Immunohistochemistry-Paraffin: FAIM2 Antibody [NBP2-33537] - Staining of human kidney.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAIM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAIM2 Antibody - BSA Free (NBP2-33537) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAIM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAIM2 Protein (NBP2-33537PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FAIM2 Antibody - BSA Free

• Fas apoptotic inhibitory molecule 2
• KIAA0950NGP35
• LFG2
• LFGLIFEGUARD
• NMP35neural membrane protein 35
• Protein lifeguard
• TMBIM2lifeguard
• transmembrane BAX inhibitor motif containing 2
• Transmembrane BAX inhibitor motif-containing protein 2

Background

Protects cells uniquely from Fas-induced apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAIM2
• Uniprot:
  • Q9BWQ8(Human)