FADS1 Antibody


Western Blot: FADS1 Antibody [NBP1-60085] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: FADS1 Antibody [NBP1-60085] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: FADS1 Antibody [NBP1-60085] - Titration: 2.5ug/ml Positive Control: K562 cell lysate.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FADS1 Antibody Summary

Synthetic peptides corresponding to FADS1(fatty acid desaturase 1) The peptide sequence was selected from the C terminal of FADS1. Peptide sequence FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 2.5 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FADS1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
FADS1 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FADS1 Antibody

  • D5DFLJ90273
  • Delta(5) desaturase
  • Delta(5) fatty acid desaturase
  • Delta-5 desaturase
  • delta-5 fatty acid desaturase
  • EC 1.14.19
  • EC 1.14.19.-
  • FADS6
  • fatty acid desaturase 1
  • FLJ38956
  • linoleoyl-CoA desaturase (delta-6-desaturase)-like 1
  • TU12


FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha, Mk
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FADS1 Antibody (NBP1-60085) (0)

There are no publications for FADS1 Antibody (NBP1-60085).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADS1 Antibody (NBP1-60085) (0)

There are no reviews for FADS1 Antibody (NBP1-60085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FADS1 Antibody (NBP1-60085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FADS1 Products

Bioinformatics Tool for FADS1 Antibody (NBP1-60085)

Discover related pathways, diseases and genes to FADS1 Antibody (NBP1-60085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FADS1 Antibody (NBP1-60085)

Discover more about diseases related to FADS1 Antibody (NBP1-60085).

Pathways for FADS1 Antibody (NBP1-60085)

View related products by pathway.

PTMs for FADS1 Antibody (NBP1-60085)

Learn more about PTMs related to FADS1 Antibody (NBP1-60085).

Research Areas for FADS1 Antibody (NBP1-60085)

Find related products by research area.

Blogs on FADS1

There are no specific blogs for FADS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FADS1 Antibody and receive a gift card or discount.


Gene Symbol FADS1