FADS1 Antibody (2D9)

Images

 
Western Blot: FADS1 Antibody (2D9) [H00003992-M04] - Analysis of expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: FADS1 Antibody (2D9) [H00003992-M04] - Analysis of monoclonal antibody to FADS1 on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ug/ml
Sandwich ELISA: FADS1 Antibody (2D9) [H00003992-M04] - Detection limit for recombinant GST tagged FADS1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FADS1 Antibody (2D9) Summary

Immunogen
FADS1 (NP_037534, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS
Specificity
FADS1 - fatty acid desaturase 1 (2D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FADS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FADS1 Antibody (2D9)

  • D5DFLJ90273
  • Delta(5) desaturase
  • Delta(5) fatty acid desaturase
  • Delta-5 desaturase
  • delta-5 fatty acid desaturase
  • EC 1.14.19
  • EC 1.14.19.-
  • FADS6
  • FADSD5LLCDL1
  • fatty acid desaturase 1
  • FLJ38956
  • linoleoyl-CoA desaturase (delta-6-desaturase)-like 1
  • TU12

Background

The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84311
Species: Hu
Applications: IHC, IHC-P
AF7550
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84752
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91877
Species: Hu
Applications: IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00054898-P01
Species: Hu
NBP1-59539
Species: Hu
Applications: WB
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FADS1 Antibody (H00003992-M04) (0)

There are no publications for FADS1 Antibody (H00003992-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADS1 Antibody (H00003992-M04) (0)

There are no reviews for FADS1 Antibody (H00003992-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FADS1 Antibody (H00003992-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FADS1 Products

Bioinformatics Tool for FADS1 Antibody (H00003992-M04)

Discover related pathways, diseases and genes to FADS1 Antibody (H00003992-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FADS1 Antibody (H00003992-M04)

Discover more about diseases related to FADS1 Antibody (H00003992-M04).
 

Pathways for FADS1 Antibody (H00003992-M04)

View related products by pathway.

PTMs for FADS1 Antibody (H00003992-M04)

Learn more about PTMs related to FADS1 Antibody (H00003992-M04).
 

Research Areas for FADS1 Antibody (H00003992-M04)

Find related products by research area.

Blogs on FADS1

There are no specific blogs for FADS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FADS1 Antibody (2D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FADS1
Entrez
Uniprot