Recombinant Human FACL4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FACL4 Protein [H00002182-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FACL4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 581-670 of Human FACL4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACSL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FACL4 GST (N-Term) Protein

  • ACS4mental retardation, X-linked 68
  • acyl-CoA synthetase 4
  • acyl-CoA synthetase long-chain family member 4
  • EC 6.2.1.3
  • FACL4long-chain 4
  • LACS 4
  • LACS4MRX68
  • lignoceroyl-CoA synthase
  • Long-chain acyl-CoA synthetase 4
  • long-chain fatty-acid-Coenzyme A ligase 4
  • long-chain-fatty-acid--CoA ligase 4
  • mental retardation, X-linked 63
  • MRX63

Background

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89270
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59645
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-15252
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92089
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87691
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-15253
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-10797
Species: Hu
Applications: WB
NBP2-20237
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-33485
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB

Publications for FACL4 Partial Recombinant Protein (H00002182-Q01) (0)

There are no publications for FACL4 Partial Recombinant Protein (H00002182-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FACL4 Partial Recombinant Protein (H00002182-Q01) (0)

There are no reviews for FACL4 Partial Recombinant Protein (H00002182-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FACL4 Partial Recombinant Protein (H00002182-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FACL4 Products

Bioinformatics Tool for FACL4 Partial Recombinant Protein (H00002182-Q01)

Discover related pathways, diseases and genes to FACL4 Partial Recombinant Protein (H00002182-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FACL4 Partial Recombinant Protein (H00002182-Q01)

Discover more about diseases related to FACL4 Partial Recombinant Protein (H00002182-Q01).
 

Pathways for FACL4 Partial Recombinant Protein (H00002182-Q01)

View related products by pathway.

PTMs for FACL4 Partial Recombinant Protein (H00002182-Q01)

Learn more about PTMs related to FACL4 Partial Recombinant Protein (H00002182-Q01).
 

Research Areas for FACL4 Partial Recombinant Protein (H00002182-Q01)

Find related products by research area.

Blogs on FACL4

There are no specific blogs for FACL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689
FACL4 Antibody
NBP2-16401

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FACL4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSL4