FABP6 Recombinant Protein Antigen

Images

 
There are currently no images for FABP6 Protein (NBP1-83129PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FABP6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FABP6.

Source: E.coli

Amino Acid Sequence: AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKMFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
FABP6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83129.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FABP6 Recombinant Protein Antigen

  • FABP6
  • fatty acid binding protein 6, ileal
  • Fatty acid-binding protein 6
  • Gastrotropin
  • I-15P
  • I-15PIntestinal 15 kDa protein
  • IBABP
  • I-BABPIntestinal bile acid-binding protein
  • I-BALB
  • I-BAP
  • ILBP
  • ILBP3
  • ILBPGT
  • ileal bile acid binding protein
  • ILLBP
  • ILLBPIleal lipid-binding protein
  • illeal lipid-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83129PEP
Species: Hu
Applications: AC

Publications for FABP6 Protein (NBP1-83129PEP) (0)

There are no publications for FABP6 Protein (NBP1-83129PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP6 Protein (NBP1-83129PEP) (0)

There are no reviews for FABP6 Protein (NBP1-83129PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FABP6 Protein (NBP1-83129PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FABP6 Products

Bioinformatics Tool for FABP6 Protein (NBP1-83129PEP)

Discover related pathways, diseases and genes to FABP6 Protein (NBP1-83129PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP6 Protein (NBP1-83129PEP)

Discover more about diseases related to FABP6 Protein (NBP1-83129PEP).
 

Pathways for FABP6 Protein (NBP1-83129PEP)

View related products by pathway.

Research Areas for FABP6 Protein (NBP1-83129PEP)

Find related products by research area.

Blogs on FABP6

There are no specific blogs for FABP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FABP6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP6
Entrez