FABP6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FABP6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FABP6.
  
  

  Source: E. coli

  Amino Acid Sequence: AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKMFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FABP6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83129.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FABP6 Recombinant Protein Antigen

• FABP6
• fatty acid binding protein 6, ileal
• Fatty acid-binding protein 6
• Gastrotropin
• I-15P
• I-15PIntestinal 15 kDa protein
• IBABP
• I-BABPIntestinal bile acid-binding protein
• I-BALB
• I-BAP
• ILBP
• ILBP3
• ILBPGT
• ileal bile acid binding protein
• ILLBP
• ILLBPIleal lipid-binding protein
• illeal lipid-binding protein

Background

Belonging to the Fatty-acid binding protein (FABP) family of cytoplasmic proteins, FABP6 binds long-chain fatty acids and other hydrophobic ligands. This protein encodes the ileal fatty acid binding protein and binds to bile salts and bilirubins. This protein is also known to stimulate gastric acid and pepsinogen secretion. The main functions of FABP6 include fatty acid uptake, transport, and metabolism. It's also involved in bile acid and bile salt transport, bile acid metabolic process, lipid metabolic process, negative regulation of cell proliferation, small molecule metabolic process and steroid metabolic process transport. Popular diseases for FABP6 include colorectal cancer, major depression and colorectal adenocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FABP6