FABP2/I-FABP Antibody (2F7)

ELISA: FABP2/I-FABP Antibody (2F7) [H00002169-M11] - Detection limit for recombinant GST tagged FABP2 is 0.3 ng/ml as a capture antibody.

Product Discontinued

FABP2/I-FABP Antibody (2F7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: FABP2 (NP_000125.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL
• Specificity: FABP2 - fatty acid binding protein 2, intestinal (2F7)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FABP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP2/I-FABP Antibody (2F7)

• FABP2
• FABPI
• fatty acid binding protein 2, intestinal
• Fatty acid-binding protein 2
• fatty acid-binding protein, intestinal
• IFABP
• I-FABP
• I-FABPMGC133132
• Intestinal FABP
• Intestinal-type fatty acid-binding protein

Background

The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FABP2
• Entrez:
  • 2169(Human)
• Uniprot:
  • NP_000125()