FABP2/I-FABP Antibody (2F7)

Images

 
ELISA: FABP2/I-FABP Antibody (2F7) [H00002169-M11] - Detection limit for recombinant GST tagged FABP2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FABP2/I-FABP Antibody (2F7) Summary

Immunogen
FABP2 (NP_000125.1, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL
Specificity
FABP2 - fatty acid binding protein 2, intestinal (2F7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FABP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP2/I-FABP Antibody (2F7)

  • FABP2
  • FABPI
  • fatty acid binding protein 2, intestinal
  • Fatty acid-binding protein 2
  • fatty acid-binding protein, intestinal
  • IFABP
  • I-FABP
  • I-FABPMGC133132
  • Intestinal FABP
  • Intestinal-type fatty acid-binding protein

Background

The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-35006
Species: Hu
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00002169-M11
Species: Hu
Applications: ELISA

Publications for FABP2/I-FABP Antibody (H00002169-M11) (0)

There are no publications for FABP2/I-FABP Antibody (H00002169-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP2/I-FABP Antibody (H00002169-M11) (0)

There are no reviews for FABP2/I-FABP Antibody (H00002169-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FABP2/I-FABP Antibody (H00002169-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP2/I-FABP Products

Bioinformatics Tool for FABP2/I-FABP Antibody (H00002169-M11)

Discover related pathways, diseases and genes to FABP2/I-FABP Antibody (H00002169-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP2/I-FABP Antibody (H00002169-M11)

Discover more about diseases related to FABP2/I-FABP Antibody (H00002169-M11).
 

Pathways for FABP2/I-FABP Antibody (H00002169-M11)

View related products by pathway.

PTMs for FABP2/I-FABP Antibody (H00002169-M11)

Learn more about PTMs related to FABP2/I-FABP Antibody (H00002169-M11).

Blogs on FABP2/I-FABP

There are no specific blogs for FABP2/I-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP2/I-FABP Antibody (2F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP2
Entrez
Uniprot