FAAH Antibody

Images

 
Immunohistochemistry-Paraffin: FAAH Antibody [NBP1-83937] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAAH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAAH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAAH Protein (NBP1-83937PEP)
Publications
Read Publication using NBP1-83937.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (84%). Reactivity reported in scientific literature (PMID: 23374458)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAAH Antibody

  • Anandamide amidohydrolase 1
  • EC 3.5.1
  • EC 3.5.1.99
  • EC 3.5.1.n2
  • FAAH1
  • FAAH-1
  • fatty acid amide hydrolase
  • fatty-acid amide hydrolase 1
  • MGC102823
  • MGC138146
  • Oleamide hydrolase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4886
Species: Mu
Applications: WB, IP
NB100-2307
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-57234
Species: Hu
Applications: ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for FAAH Antibody (NBP1-83937)(1)

Reviews for FAAH Antibody (NBP1-83937) (0)

There are no reviews for FAAH Antibody (NBP1-83937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAAH Antibody (NBP1-83937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAAH Products

Bioinformatics Tool for FAAH Antibody (NBP1-83937)

Discover related pathways, diseases and genes to FAAH Antibody (NBP1-83937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAAH Antibody (NBP1-83937)

Discover more about diseases related to FAAH Antibody (NBP1-83937).
 

Pathways for FAAH Antibody (NBP1-83937)

View related products by pathway.

PTMs for FAAH Antibody (NBP1-83937)

Learn more about PTMs related to FAAH Antibody (NBP1-83937).
 

Research Areas for FAAH Antibody (NBP1-83937)

Find related products by research area.

Blogs on FAAH

There are no specific blogs for FAAH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAAH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAAH