F-Spondin/SPON1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human F-Spondin/SPON1. Source: E. coli
Amino Acid Sequence: SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SPON1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69044. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for F-Spondin/SPON1 Recombinant Protein Antigen
Background
SPON1 is a member of a subgroup of the thrombospondin type 1 (TSR) class molecules, defined by two domains of homology, the FS1/FS2 and TSR domains. The TSRs of SPON1 proteins are typical of class 2 TSRs. SPON1, which is similar to thrombospondin, is a extracellular matrix attached molecule that promotes neurite outgrowth and inhibits angiogenesis. Analysis of gain and loss of function experiments reveal that SPON1 is required for accurate pathfinding of embryonic axons, and plays a dual role in patterning axonal trajectories. It promotes the outgrowth of commissural and inhibits the outgrowth of motor axons, and has also been implicated in inflammatory processes in the nervous system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP) (0)
There are no publications for F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP) (0)
There are no reviews for F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP) (0)
Additional F-Spondin/SPON1 Products
Research Areas for F-Spondin/SPON1 Recombinant Protein Antigen (NBP2-69044PEP)
Find related products by research area.
|
Blogs on F-Spondin/SPON1