Home » F-box protein 43 » F-box protein 43 Antibodies » F-box protein 43 Antibody

F-box protein 43 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: F-box protein 43 Antibody [NBP1-84710] - Staining of human bone marrow shows strong cytoplasmic positivity in subsets of bone marrow poietic cells.
Immunohistochemistry-Paraffin: F-box protein 43 Antibody [NBP1-84710] - Staining of human bone marrow shows strong cytoplasmic positivity in subsets of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

F-box protein 43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFVTPISNLVANIRFNASQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGS
Specificity
Specificity of human F-box protein 43 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
F-box protein 43 Protein (NBP1-84710PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for F-box protein 43 Antibody

  • early mitotic inhibitor 2
  • EMI2Fbx43
  • Endogenous meiotic inhibitor 2
  • ERP1
  • F-box only protein 43
  • F-box protein 43
  • FBX43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Species: Hu
Applications: WB, IHC, IHC-P, KD
GM-CSF
[Unconjugated]
215-GM/CF
1 μg/lane of Recombinant Human GM-CSF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human GM-CSF (Catalog # 215-IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 6-30 pg/mL.
(203 Publications)
Species: Hu
APC Antibody
NB100-91662
Western Blot: APC Antibody [NB100-91662] - Lane1:Hela cell lysate. Lane2:HEK293T cell lysate. Lane3:Rat testis tissue lysate.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - IHC-P analysis of a formalin fixed paraffin embedded tissue section of human colon cancer xenograft using 1: 50 dilution of APC antibody.
Western Blot: APC Antibody [NB100-91662] - Extracts from COLO205 cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Coagulation Factor
XIV/Protein C Antibod ...
NBP2-66987
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Analysis of paraffin-embedded human liver tissue using anti-Protein C antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: Coagulation Factor XIV/Protein C Antibody (JM93-61) [NBP2-66987] - Staining Protein C in 293T cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EMI1 Antibody
NBP1-84850
Western Blot: EMI1 Antibody [NBP1-84850] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: EMI1 Antibody [NBP1-84850] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EMI1 Antibody [NBP1-84850] - Staining of human bone marrow shows moderate positivity in hematopoietic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PLK1 Antibody
NB100-547
Western Blot: PLK1 Antibody [NB100-547] - Detection of Human PLK1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PLK1 antibody NB100-547 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunocytochemistry/Immunofluorescence: PLK1 Antibody [NB100-547] - Asynchronous HeLa cells. Antibody used at 0.5 ug/ml (left panel) and 0.2 ug/ml (right panel). Cells were counterstained with DAPI.
Western Blot: PLK1 Antibody [NB100-547] - Detection of Human PLK1 on HeLa whole cell lysate using NB100-547. B. Affinity purified rabbit anti-PLK1 antibodies NB100-546, NB100-547, and NB100-548. IPed PLK1 was detected using NB100-548.
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MOS Antibody
NBP1-86241
Western Blot: MOS Antibody [NBP1-86241] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MOS Antibody [NBP1-86241] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
MOCOS Antibody
NBP2-14243
Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: MOCOS Antibody [NBP2-14243] - Immunofluorescent staining of human cell line RT4 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomach, lower shows strong cytoplasmic positivity in gastric parietal cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining in human lymph node and liver tissues using anti-POLD1 antibody. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPP2R4 Antibody
(4D9)
NBP2-37530
Western Blot: PPP2R4 Antibody (4D9) [NBP2-37530] - Western blot analysis using PPP2R4 mAb against human PPP2R4 (AA: 1-154) recombinant protein. (Expected MW is 41 kDa)
Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody (4D9) [NBP2-37530] - Immunofluorescence analysis of Hela cells using PPP2R4 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: PPP2R4 Antibody (4D9) [NBP2-37530] - Immunohistochemical analysis of paraffin-embedded cervical cancer tissues using PPP2R4 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Apolipoprotein
H/ApoH Antibody
NBP1-90046
Western Blot: Apolipoprotein H/ApoH Antibody [NBP1-90046] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Apolipoprotein H/ApoH Antibody [NBP1-90046] - Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Apolipoprotein H/ApoH Antibody [NBP1-90046] - Staining of human liver shows moderate cytoplasmic positivity, with a granular pattern, in hepatocytes.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Mesothelin
Antibody (MB-G10)
NB110-85538
Western Blot: Mesothelin Antibody (MB-G10) [NB110-85538] - Detection of mesothelin-Fc at 100 ng (lane 1), 25 ng (lane 2), 6 ng (lane 3), 2 ng (lane 4) and 0.4 ng (lane 5). Lane 6 contains 50 ng of CDC25-Fc. Proteins were separated on 4-20% gradient gel by SDS-PAGE followed by transfer to PVDF membrane. Primary antibody was used at 1 g/ml followed by reaction with ALP goat anti-mouse IgG and BCI:5840-6.
Immunohistochemistry-Paraffin: Mesothelin Antibody (MB-G10) [NB110-85538] - Human tissue sections treated by antigen retrieval methods. Primary antibodies were used to label these sections as follows: C, MAb MB; and D, MAb MN. Reprinted with permission fromClin.Cancer Res. 11(16):5840-6.
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Cyclin B1 Antibody
[Unconjugated]
AF6000
Western blot shows lysates of U2OS human osteosarcoma cell line, K562 human chronic myelogenous leukemia cell line, HeLa human cervical epithelial carcinoma cell line, and Jurkat human acute T cell leukemia cell line. PVDF Membrane was probed with 0.2 µg/mL of Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclin B1 at approximately 62 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclin B1 at approximately 67 kDa (as indicated) using 2 µg/mL of Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Cyclin B1 was detected in immersion fixed paraffin-embedded sections of human lymphoma using Goat Anti-Human/Mouse Cyclin B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6000) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counter­stained with hematoxylin (blue). Specific staining was localized to cytoplasm in lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, IHC
beta-TrCP1/BTRC
Antibody (763524)
MAB7675
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human beta -TrCP1/BTRC Monoclonal Antibody (Catalog # MAB7675) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for beta -TrCP1/BTRC at approximately 62 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line, loaded at 0.5 mg/mL. A specific band was detected for beta -TrCP1/BTRC at approximately 84 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human beta -TrCP1/BTRC Monoclonal Antibody (Catalog # MAB7675). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
beta ‑TrCP1/BTRC was detected in immersion fixed A172 human glioblastoma cell line using Mouse Anti-Human beta ‑TrCP1/BTRC Monoclonal Antibody (Catalog # MAB7675) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, Simple Western, ICC
SCF/c-kit Ligand
[Unconjugated]
255-SC/CF
1 μg/lane of Recombinant Human SCF/c-kit Ligand was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 19 kDa.
Recombinant Human SCF/c-kit Ligand (Catalog # 255-SC/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 1-5 ng/mL.
(109 Publications)
Species: Hu
Cdc20 Antibody
NB100-59828
Western Blot: Cdc20 Antibody [NB100-59828] - Detection of Human and Mouse CDC20 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CDC20 antibody NB100-59828 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: Cdc20 Antibody [NB100-59828] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-CDC20 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
Western Blot: Cdc20 Antibody [NB100-59828] - Detection of Human CDC20 on HeLa whole cell lysate using NB100-59828. CDC20 was also immunoprecipitated by rabbit anti-CDC20 antibody NB100-59827.
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for F-box protein 43 Antibody (NBP1-84710) (0)

There are no publications for F-box protein 43 Antibody (NBP1-84710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for F-box protein 43 Antibody (NBP1-84710) (0)

There are no reviews for F-box protein 43 Antibody (NBP1-84710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for F-box protein 43 Antibody (NBP1-84710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional F-box protein 43 Products

Bioinformatics Tool for F-box protein 43 Antibody (NBP1-84710)

Discover related pathways, diseases and genes to F-box protein 43 Antibody (NBP1-84710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for F-box protein 43 Antibody (NBP1-84710)

Discover more about diseases related to F-box protein 43 Antibody (NBP1-84710).
 

Pathways for F-box protein 43 Antibody (NBP1-84710)

View related products by pathway.

PTMs for F-box protein 43 Antibody (NBP1-84710)

Learn more about PTMs related to F-box protein 43 Antibody (NBP1-84710).
 

Research Areas for F-box protein 43 Antibody (NBP1-84710)

Find related products by research area.

Blogs on F-box protein 43

There are no specific blogs for F-box protein 43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our F-box protein 43 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FBXO43