F-box protein 43 Antibody

Images

 
Immunohistochemistry-Paraffin: F-box protein 43 Antibody [NBP1-84710] - Staining of human bone marrow shows strong cytoplasmic positivity in subsets of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

F-box protein 43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFVTPISNLVANIRFNASQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
F-box protein 43 Protein (NBP1-84710PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for F-box protein 43 Antibody

  • early mitotic inhibitor 2
  • EMI2Fbx43
  • Endogenous meiotic inhibitor 2
  • ERP1
  • F-box only protein 43
  • F-box protein 43
  • FBX43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5087
Species: Hu
Applications: WB, Simple Western, IHC
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for F-box protein 43 Antibody (NBP1-84710) (0)

There are no publications for F-box protein 43 Antibody (NBP1-84710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for F-box protein 43 Antibody (NBP1-84710) (0)

There are no reviews for F-box protein 43 Antibody (NBP1-84710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for F-box protein 43 Antibody (NBP1-84710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional F-box protein 43 Products

Bioinformatics Tool for F-box protein 43 Antibody (NBP1-84710)

Discover related pathways, diseases and genes to F-box protein 43 Antibody (NBP1-84710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for F-box protein 43 Antibody (NBP1-84710)

Discover more about diseases related to F-box protein 43 Antibody (NBP1-84710).
 

Pathways for F-box protein 43 Antibody (NBP1-84710)

View related products by pathway.

PTMs for F-box protein 43 Antibody (NBP1-84710)

Learn more about PTMs related to F-box protein 43 Antibody (NBP1-84710).
 

Research Areas for F-box protein 43 Antibody (NBP1-84710)

Find related products by research area.

Blogs on F-box protein 43

There are no specific blogs for F-box protein 43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our F-box protein 43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO43