EVI2A Antibody


Western Blot: EVI2A Antibody [NBP1-68926] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EVI2A Antibody Summary

Synthetic peptides corresponding to EVI2A (ecotropic viral integration site 2A) The peptide sequence was selected from the C terminal of EVI2A. Peptide sequence LSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against EVI2A and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EVI2A Antibody

  • ecotropic viral integration site 2A
  • EVDAEVI2Ecotropic viral integration site 2A protein homolog
  • EVI-2A
  • protein EVI2A


EVI2A may complex with itself or/and other proteins within the membrane, to function as part of a cell-surface receptor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, ICC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for EVI2A Antibody (NBP1-68926) (0)

There are no publications for EVI2A Antibody (NBP1-68926).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVI2A Antibody (NBP1-68926) (0)

There are no reviews for EVI2A Antibody (NBP1-68926). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EVI2A Antibody (NBP1-68926) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EVI2A Products

Bioinformatics Tool for EVI2A Antibody (NBP1-68926)

Discover related pathways, diseases and genes to EVI2A Antibody (NBP1-68926). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVI2A Antibody (NBP1-68926)

Discover more about diseases related to EVI2A Antibody (NBP1-68926).

Pathways for EVI2A Antibody (NBP1-68926)

View related products by pathway.

PTMs for EVI2A Antibody (NBP1-68926)

Learn more about PTMs related to EVI2A Antibody (NBP1-68926).

Blogs on EVI2A

There are no specific blogs for EVI2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EVI2A Antibody and receive a gift card or discount.


Gene Symbol EVI2A